SecReT6
Protein ID: 530629761
SecReT6 ID840
T6SS typeN/A
Gene symbol-
Locus tagN559_2027
StrainKlebsiella pneumoniae JM45
Repliconchromosome [GenBank: NC_022082] [Browse all T6SS(s) in this replicon]
Location [Strand]2076589..2078352 [+]
Producthypothetical protein
NoteTssF
UniProt IDS5ZPH8
KEGG IDkpj:N559_2027
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.10E-183, Aligned region: 6..582
Protein Sequence: 587 a.a.     [Download]
>gi|530629761|ref|YP_008425029.1| hypothetical protein N559_2027 [Klebsiella pneumoniae JM45]
MDDLTLRYFDAEMRYLREAAKAFAQAHPDRAAMLDLDKAGTPDPYVERLFEGFAFSVGRLREKIDDDLPE
LTEGLVSMLWPHYLRTIPSLSIVALTPTLPAMKMAETVPAGFEISSRPLGPKNTVCRYRTTRDLTLNPLA
IEEAVMTAEPDGRSALRLRLACSELADWSQTDLRRLALYLGEDAVTGSALHLWLTRRQAALYLRLPGQTE
RVSLDGYFSPGGFSEEDCLWPKGESAFSGYQLLLEYFTFREKFMFVQLNGLENITLPAGISHFTLEVVFS
EVWQSDLPVSASSLRLHCVPVINLFTLEADPLTISGLESEYLLRPKRLQDGHTEIYSVDSVTGSGRTGEA
RYVPFTRFRHQGGMMRRHAPERYYHTRVKRGVTGMHDTWLILGGQQWEADRELARETVSLRITGTNGQLP
RRALQSTLLDRCESISATPLTVRNLCKPTLPAYPPAEDRYHWRVMSHLGTRFLNMMSSAEVLRGTLSLYN
WREDELNNRRLDAILAVSHHRIQRFEQGFLLRGLDIEVTLDGSGFTGAGDVHLFGDMLNRFFALYADMNQ
FNQLTLIVQPDGKCIRWKENHSLRLPG
 
Nucleotide Sequence: 1764 bp     [Download]
>gi|530627845|ref|NC_022082.1|:2076589-2078352 Klebsiella pneumoniae JM45, complete genome
ATGGACGATTTAACCCTGCGATATTTTGATGCTGAAATGCGCTACCTGCGCGAGGCGGCAAAAGCGTTCG
CGCAGGCTCACCCCGATCGGGCGGCGATGCTGGATCTCGATAAAGCCGGTACGCCGGACCCTTACGTTGA
GCGCCTGTTTGAAGGCTTTGCCTTTTCCGTAGGTCGCTTGCGCGAAAAAATTGATGATGATCTGCCGGAG
CTGACCGAGGGGCTGGTCAGCATGCTGTGGCCGCACTATTTGCGCACTATTCCATCGCTATCGATCGTGG
CGCTGACCCCAACGCTGCCGGCGATGAAGATGGCGGAAACGGTGCCCGCCGGGTTTGAGATTAGCTCCCG
CCCACTGGGGCCGAAAAATACCGTGTGCCGGTACCGAACCACCCGCGATCTGACGCTTAACCCGCTGGCG
ATAGAGGAGGCGGTGATGACGGCGGAGCCGGACGGACGTTCGGCCCTGCGACTACGACTCGCCTGTAGCG
AGCTGGCTGACTGGTCGCAGACCGATCTCCGCCGCCTGGCGCTGTACCTGGGGGAAGACGCTGTTACCGG
CAGCGCCCTCCATCTGTGGCTGACCCGACGCCAGGCCGCGCTGTACCTGCGTCTGCCGGGTCAGACAGAG
CGGGTAAGCCTCGACGGCTATTTTTCCCCGGGGGGATTCAGCGAGGAGGATTGTTTATGGCCGAAGGGGG
AGAGCGCTTTCAGCGGCTATCAGCTGCTGCTCGAGTATTTCACCTTTCGCGAAAAATTTATGTTCGTGCA
GCTAAATGGCCTGGAAAACATCACCCTGCCGGCGGGGATATCGCATTTCACGCTTGAGGTGGTGTTCAGC
GAGGTCTGGCAAAGTGATTTACCCGTCAGCGCAAGCAGCCTGCGCCTGCACTGTGTGCCGGTGATTAACC
TGTTTACCCTTGAGGCCGATCCGTTGACCATCAGCGGGCTGGAGAGCGAATATCTCCTGCGTCCGAAGCG
CCTGCAGGACGGGCATACCGAAATCTATTCTGTTGACAGCGTGACCGGCTCCGGGCGCACCGGGGAGGCA
CGCTATGTGCCTTTCACCCGCTTTCGTCACCAGGGGGGAATGATGCGTCGCCATGCGCCGGAGCGCTACT
ACCACACCCGCGTAAAACGGGGCGTAACCGGCATGCACGATACCTGGCTTATCCTCGGCGGACAGCAATG
GGAGGCTGACCGGGAGCTGGCGCGGGAAACGGTCTCCTTGCGCATCACCGGCACTAACGGCCAGCTGCCG
CGCCGGGCGCTACAGAGCACGCTGCTGGATCGCTGTGAGTCGATATCAGCCACGCCGCTTACCGTCCGCA
ATCTCTGTAAGCCCACGCTGCCGGCCTATCCCCCGGCGGAAGACCGCTACCACTGGCGGGTCATGAGCCA
TCTGGGCACCCGTTTTCTCAACATGATGAGCAGCGCCGAGGTGCTGCGCGGCACGCTGTCGCTCTACAAC
TGGCGGGAGGATGAGCTCAATAATCGCCGTCTGGACGCCATTCTGGCGGTCAGCCATCACCGAATTCAGC
GTTTCGAGCAGGGTTTCCTGCTGCGCGGGCTGGATATTGAAGTGACGCTCGACGGTAGCGGATTTACCGG
TGCGGGCGATGTCCACCTGTTTGGCGACATGCTCAACCGCTTTTTCGCACTGTATGCCGATATGAATCAG
TTCAACCAGCTGACGCTCATTGTTCAACCTGATGGGAAATGTATCCGGTGGAAAGAGAATCACAGTCTGC
GCCTGCCCGGCTGA