SecReT6
Protein ID: 530629762
SecReT6 ID840
T6SS typeN/A
Gene symbol-
Locus tagN559_2028
StrainKlebsiella pneumoniae JM45
Repliconchromosome [GenBank: NC_022082] [Browse all T6SS(s) in this replicon]
Location [Strand]2078307..2079398 [+]
Producttype VI secretion protein, VC_A0111 family
NoteTssG
UniProt IDS5YMP0
KEGG IDkpj:N559_2028
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.50E-82, Aligned region: 23..324
Protein Sequence: 363 a.a.     [Download]
>gi|530629762|ref|YP_008425030.1| type VI secretion protein, VC_A0111 family [Klebsiella pneumoniae JM45]
MYPVERESQSAPARLMAQLRPQLPYMNFYRFCQLLEKNHPKAPIIGSGWLVGDEPIRFRPHPGMGFPAGE
IRGMDDPEPPRPPAVRVTFMGLYGVESPLPTHYSDDIAQRREGVEATEDFLDIFNHRLIAQYYRIWRKYS
YPATFRAGGTDNISQYLLGLAGLGIPGCAAVAAAPLSRFLALLPVMMLPGRSGEGMEALVALLAPGTRAT
VHHHDPCRIPLSQPLTMSVRQPVSLQHRPVMGTHATDVNGQVLLQLATEKPDEVRGWLPGGELFSDLMAL
LHVWLGSHLDVRLQLCVARHLLPDAQLCCQQEHAVQLGRTAVLRPLDAQKQADDRVTIYLGRYQRVRENI
HRRESDEDGDYRS
 
Nucleotide Sequence: 1092 bp     [Download]
>gi|530627845|ref|NC_022082.1|:2078307-2079398 Klebsiella pneumoniae JM45, complete genome
ATGTATCCGGTGGAAAGAGAATCACAGTCTGCGCCTGCCCGGCTGATGGCGCAGCTCCGGCCTCAGTTGC
CGTACATGAATTTTTACCGCTTCTGCCAGTTGCTGGAGAAGAACCATCCGAAGGCGCCGATCATCGGCAG
CGGCTGGCTAGTAGGTGATGAACCCATACGCTTTCGCCCGCATCCGGGGATGGGCTTTCCGGCTGGCGAA
ATCCGTGGAATGGACGATCCTGAACCGCCCCGTCCGCCGGCGGTTCGCGTGACTTTTATGGGACTCTACG
GCGTGGAATCCCCGCTGCCGACCCACTATAGCGATGACATTGCGCAACGGCGGGAAGGCGTCGAGGCCAC
CGAGGATTTCCTCGATATCTTTAACCATCGGCTGATCGCCCAGTATTACCGTATCTGGCGCAAATATTCC
TACCCGGCAACCTTTCGGGCGGGCGGCACGGACAACATCTCGCAGTATCTGCTGGGCCTGGCGGGGCTGG
GCATACCGGGATGTGCCGCCGTTGCCGCAGCGCCGCTGTCGCGATTTCTGGCGCTGCTGCCGGTGATGAT
GCTGCCGGGGAGATCCGGGGAAGGCATGGAGGCGCTGGTGGCGCTCCTGGCCCCGGGGACCCGGGCGACG
GTGCACCACCACGATCCCTGCCGGATCCCCTTGTCGCAGCCGTTAACGATGAGCGTCCGTCAGCCGGTTA
GCCTGCAACATAGGCCAGTGATGGGAACCCACGCCACGGATGTGAACGGTCAGGTATTGCTGCAGCTGGC
CACGGAAAAGCCTGATGAGGTTCGCGGCTGGCTGCCCGGCGGCGAACTGTTCAGCGACCTGATGGCGCTT
CTGCACGTCTGGCTCGGATCTCATCTTGACGTGCGGCTGCAGCTTTGCGTCGCCCGCCATTTACTGCCGG
ATGCGCAACTTTGCTGCCAGCAGGAGCATGCCGTCCAGCTCGGCCGTACCGCTGTGCTGCGTCCGCTGGA
TGCGCAGAAACAGGCTGACGACAGAGTCACGATTTATCTGGGGCGCTATCAGCGCGTCCGGGAAAATATC
CACCGCAGGGAGAGCGATGAAGATGGCGATTACCGCAGTTAA