SecReT6
Protein ID: 530629763
SecReT6 ID840
T6SS typeN/A
Gene symbol-
Locus tagN559_2029
StrainKlebsiella pneumoniae JM45
Repliconchromosome [GenBank: NC_022082] [Browse all T6SS(s) in this replicon]
Location [Strand]2079427..2079915 [+]
Producthypothetical protein
NoteTssJ
UniProt IDS5Z7D1
KEGG IDkpj:N559_2029
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.50E-38, Aligned region: 3..153
Protein Sequence: 162 a.a.     [Download]
>gi|530629763|ref|YP_008425031.1| hypothetical protein N559_2029 [Klebsiella pneumoniae JM45]
MVTVLTGCGLTQTVKDGAVSVTQSIFYPQVKTLHLDLRAREGVNNNAKGASLATVVRIYQLKDRQAFDNT
DYPSLFAGDGQALQADRVAEKDVRLRPGESVTVDMPMETSAQFVAVAAMFIDPDLTQNSWRLVLTRDELD
PARPRIIEASQNQLTLHPFKEK
 
Nucleotide Sequence: 489 bp     [Download]
>gi|530627845|ref|NC_022082.1|:2079427-2079915 Klebsiella pneumoniae JM45, complete genome
ATGGTTACCGTCTTAACCGGCTGCGGACTGACGCAGACCGTGAAAGACGGCGCCGTTTCCGTGACCCAGT
CCATTTTTTACCCCCAGGTGAAAACCCTGCATCTGGATCTTCGCGCCCGGGAAGGCGTGAATAACAACGC
CAAAGGCGCCTCCCTGGCGACGGTGGTGCGTATTTATCAGCTGAAGGACCGGCAAGCGTTCGACAATACT
GACTACCCGTCGCTGTTTGCCGGCGATGGCCAGGCGCTGCAGGCGGACCGGGTGGCGGAAAAAGATGTTC
GCCTGCGTCCGGGCGAATCGGTGACCGTCGATATGCCCATGGAAACCAGCGCGCAGTTTGTGGCGGTGGC
GGCCATGTTTATCGATCCAGACCTGACGCAAAACAGCTGGCGGCTGGTACTCACCCGGGACGAACTTGAT
CCGGCGAGGCCGCGCATTATCGAAGCCAGCCAAAATCAACTGACGCTGCACCCGTTTAAGGAGAAGTGA