SecReT6
Protein ID: 530629764
SecReT6 ID840
T6SS typeN/A
Gene symbol-
Locus tagN559_2030
StrainKlebsiella pneumoniae JM45
Repliconchromosome [GenBank: NC_022082] [Browse all T6SS(s) in this replicon]
Location [Strand]2079912..2080361 [+]
Producthypothetical protein
NoteTssE
UniProt IDS5YG66
KEGG IDkpj:N559_2030
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 4.60E-16, Aligned region: 28..115
Protein Sequence: 149 a.a.     [Download]
>gi|530629764|ref|YP_008425032.1| hypothetical protein N559_2030 [Klebsiella pneumoniae JM45]
MKMPRPSLYDILYGNFAGGLDLNTVSETDQVILSVLDNMQRILNCRAGTLAHLPDYGLPDMTAVLQGMPA
SAHQLMSTLSAVLLKYEPRLQRIAVVMLDQHAPGELRYAIDAELKDIGLVRYGTEFMPEGRVLIRHLKRQ
QYLDARSAL
 
Nucleotide Sequence: 450 bp     [Download]
>gi|530627845|ref|NC_022082.1|:2079912-2080361 Klebsiella pneumoniae JM45, complete genome
GTGAAAATGCCTCGTCCCTCCCTGTATGACATCCTGTACGGCAATTTCGCCGGCGGGCTTGACCTGAATA
CTGTCAGCGAAACGGATCAGGTCATCCTGTCGGTGCTCGATAACATGCAGCGCATCCTCAACTGTCGGGC
CGGAACGCTGGCGCATCTGCCGGACTACGGCCTGCCGGATATGACCGCTGTCCTCCAGGGGATGCCAGCG
TCGGCGCATCAGCTGATGAGCACATTGTCGGCGGTGTTGTTGAAATACGAACCGCGCCTGCAGCGGATCG
CGGTGGTGATGCTCGATCAGCATGCGCCCGGCGAACTGCGCTATGCCATTGATGCGGAGCTGAAGGATAT
TGGCCTGGTGCGTTACGGCACGGAGTTTATGCCCGAGGGCAGGGTGTTGATCCGCCACCTCAAACGCCAG
CAGTACCTTGACGCCCGCTCCGCCCTCTAA