SecReT6
Protein ID: 530629765
SecReT6 ID840
T6SS typeN/A
Gene symbol-
Locus tagN559_2031
StrainKlebsiella pneumoniae JM45
Repliconchromosome [GenBank: NC_022082] [Browse all T6SS(s) in this replicon]
Location [Strand]2080381..2081796 [+]
Producthypothetical protein
NoteTssA
UniProt IDS5YUT0
KEGG IDkpj:N559_2031
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 3.00E-51, Aligned region: 36..61
DUF3702 [PF12486], Evalue: 3.00E-51, Aligned region: 90..178
DUF3702 [PF12486], Evalue: 3.00E-51, Aligned region: 303..447
ImpA-rel_N [PF06812], Evalue: 1.30E-17, Aligned region: 41..100
ImpA-rel_N [PF06812], Evalue: 1.30E-17, Aligned region: 324..340
ImpA-rel_N [PF06812], Evalue: 1.30E-17, Aligned region: 356..374
Protein Sequence: 471 a.a.     [Download]
>gi|530629765|ref|YP_008425033.1| hypothetical protein N559_2031 [Klebsiella pneumoniae JM45]
MMTTHHDRHYKAGGDPRTLADFMALRAEMNKLSHPARPDINWPYAEQLARGLLEHHGADLQTVAWYTLAR
ARLGGVAGINEGLTLMESLLVRQGKNLWPQALPARTEIFRTLSKRLRQVIRTLNLTPEDVESLEQAERSL
QSFDAVLQRLEIAPENQLSDLRALLHSTATRFESLDPAPALPTAPPVAVSDAELPGTLVSEEDAAKVEPV
PDLKRRPKAEPLAPPSPAKRPAPVAASTPAAAPRWKPFIAGMVTMLAVTGIAVGGWLALRQSDLPPISVT
QNAGPIPGLPATTPPGPVDLPQTQRQLGELARLAPDWAVSYGDQLVHQALIRWPDQAQPLAQQWRQQLSA
GALPAENLTGWSEGMQQLQRLADQLNALDEQKGKYLTVSELKTAVFAITQSFNRAVPLEEQLRQLAALPV
DQPWPAARGSLAELHLQQLIVEYALLKRKQPASPTAALPATGEPSVSEAVK
 
Nucleotide Sequence: 1416 bp     [Download]
>gi|530627845|ref|NC_022082.1|:2080381-2081796 Klebsiella pneumoniae JM45, complete genome
ATGATGACAACACACCACGACCGTCACTATAAAGCCGGTGGCGACCCGCGCACGCTGGCTGATTTTATGG
CCCTGCGTGCGGAAATGAACAAGCTCAGCCACCCGGCGCGGCCGGATATTAACTGGCCGTATGCCGAGCA
GCTTGCCCGCGGGCTGTTGGAGCATCACGGCGCGGACCTGCAGACTGTCGCCTGGTATACCCTGGCCCGC
GCCCGGCTGGGCGGGGTGGCAGGGATCAATGAGGGGCTGACGCTGATGGAGTCGCTGCTGGTTCGTCAGG
GGAAAAACCTGTGGCCACAGGCGCTCCCGGCCCGGACAGAGATCTTCCGCACCCTGAGCAAGCGGCTGCG
GCAGGTGATCCGTACCCTGAATCTTACCCCAGAGGATGTTGAGTCGCTTGAGCAGGCTGAACGTTCGCTG
CAAAGCTTCGACGCAGTGCTCCAGCGCCTTGAGATCGCCCCTGAAAACCAGCTGAGCGACCTGCGGGCGC
TACTGCACAGCACGGCAACTCGCTTCGAGAGCCTCGACCCTGCGCCAGCGCTTCCCACCGCGCCGCCGGT
GGCGGTGTCTGACGCGGAACTTCCCGGCACTCTGGTCAGCGAAGAGGATGCGGCGAAGGTTGAGCCAGTG
CCAGACCTAAAACGTAGACCAAAAGCTGAGCCGCTGGCGCCGCCTTCACCTGCAAAGCGGCCCGCGCCGG
TGGCGGCGTCTACTCCGGCAGCCGCGCCGCGCTGGAAGCCGTTTATCGCCGGGATGGTTACCATGCTGGC
GGTAACGGGTATCGCCGTCGGCGGATGGCTGGCGCTGCGTCAGTCCGACTTGCCGCCCATTTCGGTCACC
CAAAATGCCGGACCGATACCGGGCCTGCCGGCGACAACGCCCCCGGGGCCGGTTGATCTGCCACAGACGC
AGCGCCAGCTTGGCGAGCTTGCCCGCCTGGCGCCGGACTGGGCGGTCAGTTACGGCGACCAGCTGGTCCA
CCAGGCCCTGATCCGCTGGCCGGATCAGGCGCAACCGCTGGCGCAGCAGTGGCGGCAGCAGCTGAGTGCT
GGCGCATTGCCCGCGGAAAACCTTACCGGCTGGTCGGAGGGCATGCAGCAACTGCAGCGGCTCGCCGACC
AGCTCAATGCCCTCGACGAGCAGAAGGGGAAGTACCTGACGGTGAGCGAACTGAAAACCGCAGTATTTGC
CATCACGCAGTCGTTTAACCGCGCTGTTCCGCTGGAGGAGCAGCTGCGCCAGCTGGCCGCGCTTCCCGTT
GATCAACCCTGGCCAGCCGCGCGGGGAAGCCTCGCGGAGCTGCATCTGCAACAGCTGATAGTGGAGTATG
CCCTGCTGAAGCGAAAACAGCCGGCGTCGCCGACCGCTGCGCTCCCCGCAACCGGTGAGCCCTCGGTGAG
TGAGGCGGTGAAATAA