SecReT6
Protein ID: 530630587
SecReT6 ID841
T6SS typei2
Gene symbol-
Locus tagN559_2910
StrainKlebsiella pneumoniae JM45
Repliconchromosome [GenBank: NC_022082] [Browse all T6SS(s) in this replicon]
Location [Strand]2962046..2962573 [-]
Producthypothetical protein
NoteTssJ
UniProt IDS5YPT5
KEGG IDkpj:N559_2910
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.30E-35, Aligned region: 12..166
Protein Sequence: 175 a.a.     [Download]
>gi|530630587|ref|YP_008425855.1| hypothetical protein N559_2910 [Klebsiella pneumoniae JM45]
MTKTACLLPLLALCLSGCGLTQRVSEGTKSAFNAVFYKKINTLHLDFTAREALNTDARENHSLSEPVVVR
IYQLKDRQTFDRLVYQQLLEEGDILLAADLLASRDVVIGPGGDASLNMPLEAEATFVAVVGLFRHPDTQR
NTWKQVLAREELDPDKPRIFTAEHNQLRLRPEAAK
 
Nucleotide Sequence: 528 bp     [Download]
>gi|530627845|ref|NC_022082.1|:c2962573-2962046 Klebsiella pneumoniae JM45, complete genome
TTGACTAAAACCGCCTGTCTGCTGCCCCTGCTTGCGCTTTGCCTGAGCGGATGCGGACTCACCCAGCGCG
TCTCGGAGGGAACAAAGTCTGCCTTCAACGCCGTTTTTTATAAGAAAATTAATACGCTGCATCTGGACTT
TACCGCGCGCGAAGCGCTCAACACCGATGCCAGAGAGAATCACTCGCTCTCTGAACCGGTGGTGGTGCGC
ATCTATCAGCTTAAAGATCGCCAGACCTTTGACCGGCTGGTTTACCAGCAGCTGCTGGAGGAGGGGGATA
TTCTGCTCGCCGCCGATCTCCTCGCCAGTCGCGATGTGGTGATCGGTCCCGGAGGGGACGCCAGTCTGAA
TATGCCGCTGGAAGCGGAGGCGACGTTCGTGGCGGTTGTCGGCCTGTTCCGCCATCCGGACACACAAAGA
AATACCTGGAAGCAGGTGCTGGCGCGTGAGGAATTGGATCCGGACAAGCCGCGCATTTTCACCGCCGAAC
ACAACCAGCTACGGCTCAGGCCTGAAGCGGCGAAGTAA