SecReT6
Protein ID: 530630589
SecReT6 ID841
T6SS typei2
Gene symbol-
Locus tagN559_2912
StrainKlebsiella pneumoniae JM45
Repliconchromosome [GenBank: NC_022082] [Browse all T6SS(s) in this replicon]
Location [Strand]2963615..2965369 [-]
Producthypothetical protein
NoteTssF
UniProt IDS5YIA1
KEGG IDkpj:N559_2912
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.10E-180, Aligned region: 6..581
Protein Sequence: 584 a.a.     [Download]
>gi|530630589|ref|YP_008425857.1| hypothetical protein N559_2912 [Klebsiella pneumoniae JM45]
MDDLTLRYYDAEMRYLLEAGEEFARAHPEQAAMLNLDKAGARDPFVERLFEGFAFLMGRMREKLDDDLPE
LTEGVVSLLWPHYLRTIPSMSVVEFTPDWPEMKEPMTMAKGFEVLSRPIGEKGTRCRYTTTKAIALQPLS
LERVQLATDTDGRSVITLRFTCSQLTDWRRVDLSHIPLYCNADAPLACAMHEAFTLNVARMWLRMPEEVD
RRPLDGYFSALGFGEDDGLWPEDGRSFRGYQLLLEYFTFREKFMFIDLRGLETVAFPAGLAWFEIDVVLA
ERWEHDFRFSEKQLRLHCVPVINLFPLESDPLTINSLQTEYPLRPMRVQDGHTEIYTVDSVISSHQQVYA
PFSSFRHKGGMMRHDAADYYYHTRVRRGPSGLYNTWLIVGGEAFDNHTVPEDESLSLTLTGTNGQLPRRA
LQSTVLDTVMKTTSASIAVRNLCAPTLPCYPPAQDRFHWRVLSHLGSSFLSLMDNAEVLRGTLALYEWTD
SEMNRRRLEAILDVKHRATERFAQGHLVRGVQIEVTLDSHGFAGRGDICLFGEMLSRFFALYTDIYLFNR
LIIILQPTGERLEWEEKHSRRIPG
 
Nucleotide Sequence: 1755 bp     [Download]
>gi|530627845|ref|NC_022082.1|:c2965369-2963615 Klebsiella pneumoniae JM45, complete genome
ATGGACGATTTAACCCTGCGTTATTACGACGCTGAAATGCGCTACCTGCTGGAAGCGGGTGAAGAGTTTG
CCCGCGCTCATCCTGAGCAGGCGGCAATGCTCAATCTCGACAAAGCGGGCGCTCGCGACCCCTTTGTCGA
GCGTCTGTTTGAAGGTTTTGCCTTCCTGATGGGCCGCATGCGCGAGAAACTCGATGACGATCTGCCTGAG
CTGACCGAAGGCGTGGTCAGTCTGCTGTGGCCACATTATTTACGTACCATTCCCTCGATGTCGGTCGTGG
AGTTCACCCCCGACTGGCCGGAAATGAAAGAGCCGATGACGATGGCCAAAGGCTTTGAAGTGCTTTCCCG
GCCGATCGGTGAAAAGGGCACGCGCTGCCGGTACACCACCACCAAAGCGATCGCTCTGCAGCCGTTATCC
CTGGAACGCGTCCAGCTGGCCACCGATACGGATGGCCGGTCGGTGATCACGCTGCGCTTTACCTGCAGCC
AGCTGACGGACTGGCGCCGGGTCGATCTCAGTCATATCCCGCTGTACTGCAACGCCGATGCGCCGCTGGC
CTGCGCCATGCACGAGGCCTTTACCCTCAATGTGGCCCGGATGTGGCTGCGCATGCCCGAAGAGGTGGAC
AGAAGGCCGCTGGACGGGTATTTCAGCGCGCTGGGATTTGGCGAGGATGACGGCCTCTGGCCTGAAGATG
GCCGCAGTTTTCGCGGTTATCAGCTGCTGCTGGAGTATTTTACCTTCCGCGAAAAGTTCATGTTCATCGA
TCTGCGCGGGCTGGAGACGGTGGCTTTTCCGGCCGGACTGGCGTGGTTTGAAATCGACGTCGTGCTGGCG
GAACGCTGGGAACATGACTTCCGCTTCAGCGAAAAGCAGCTGCGCCTGCACTGCGTGCCAGTGATCAACC
TGTTTCCGCTGGAGTCCGATCCGCTGACCATCAATTCCCTGCAGACCGAATACCCGCTGCGCCCGATGCG
CGTGCAGGACGGCCACACCGAAATTTACACCGTCGATTCCGTGATCTCCTCACACCAGCAGGTTTACGCG
CCGTTCTCAAGTTTTCGCCACAAAGGCGGCATGATGCGTCATGACGCGGCGGACTATTACTATCATACCC
GGGTGCGCCGTGGCCCCTCCGGGCTGTACAACACCTGGCTTATCGTCGGCGGAGAAGCCTTTGATAATCA
TACCGTACCGGAAGATGAAAGCCTGTCGCTGACCCTCACCGGAACCAACGGCCAGCTGCCGCGTCGCGCG
CTGCAGAGCACCGTGCTCGATACGGTGATGAAAACCACTTCCGCCAGTATTGCAGTGCGTAACCTCTGCG
CGCCGACGCTGCCGTGCTATCCCCCCGCCCAGGACCGTTTTCACTGGCGGGTGCTGAGCCATCTGGGCAG
CAGTTTTCTTTCCCTGATGGATAACGCGGAGGTCCTGCGCGGCACCCTGGCGCTGTATGAATGGACCGAC
AGCGAGATGAATCGTCGGCGTCTGGAAGCCATCCTCGACGTGAAGCACCGCGCAACAGAGCGCTTTGCAC
AGGGCCATCTGGTGCGCGGCGTGCAGATTGAAGTCACCCTCGACAGTCACGGCTTTGCCGGACGTGGCGA
TATATGCCTGTTTGGCGAGATGCTTAGCCGCTTCTTCGCGCTCTACACCGACATCTACTTGTTCAACCGC
CTGATTATCATTCTGCAACCAACCGGAGAACGACTGGAATGGGAAGAGAAGCACAGCCGCCGCATTCCCG
GCTGA