SecReT6
Protein ID: 530630590
SecReT6 ID841
T6SS typei2
Gene symbol-
Locus tagN559_2913
StrainKlebsiella pneumoniae JM45
Repliconchromosome [GenBank: NC_022082] [Browse all T6SS(s) in this replicon]
Location [Strand]2965357..2966619 [-]
Producttype VI secretion-associated protein, VC_A0119 family
NoteTssA
UniProt IDS5YX05
KEGG IDkpj:N559_2913
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 420 a.a.     [Download]
>gi|530630590|ref|YP_008425858.1| type VI secretion-associated protein, VC_A0119 family [Klebsiella pneumoniae JM45]
MSDSLSLYPEVDMTTMQVIIGALLLAEATFSGLAEASRPDLSGLYQILENRLVQSGGAHSLVPQTSREEH
DLLPQHTDTAPVMHTVTSGRDLLDQAKVLAKYLRECPGGWLAGHHLMKSVRWDTLTELPPLDASGRTRLL
PPKPESKAHLKRLYLQKSWSELLEHTDTLLAQGVNHLWLDVQWYAWQALLKLDADSVRADILCRDMKGLL
ARLPGLETLAFNDGTPFADEVTLNWLNERVLDEMAGWQDEPVMAATTADEVLSLEPEVLTRADDEGIESA
LNWLQAQPGYTTSRNRWLMRLLMARVSEQYGKNEMALHLLAELDSRAREMTLEQWKPELIFEVKARRLRL
LRGKAGRSEAEKKSLAARNGVIACRAHRSGSCSRRGAVRIIHASFTLHSLHLRFSAYLKAITHSGDLWTI
 
Nucleotide Sequence: 1263 bp     [Download]
>gi|530627845|ref|NC_022082.1|:c2966619-2965357 Klebsiella pneumoniae JM45, complete genome
ATGTCGGACAGTCTGTCTCTTTATCCGGAAGTCGACATGACCACTATGCAGGTCATTATCGGGGCGTTAT
TGCTGGCGGAAGCCACTTTTTCCGGCTTGGCTGAAGCATCTCGCCCCGATCTTTCCGGGCTATATCAGAT
ACTGGAGAACCGCCTGGTGCAAAGCGGCGGAGCCCACAGTCTGGTGCCGCAGACCAGCCGCGAAGAACAC
GATCTGCTACCCCAACATACGGACACCGCACCGGTAATGCATACCGTCACGTCAGGTCGTGATTTGCTCG
ATCAGGCTAAGGTGCTGGCGAAATATCTGCGCGAGTGTCCCGGCGGATGGCTGGCAGGTCATCATCTGAT
GAAGAGTGTGCGTTGGGATACGTTAACGGAGTTACCGCCGCTGGATGCCTCCGGCCGGACACGGCTATTG
CCTCCCAAGCCTGAGAGTAAAGCCCATCTTAAGCGGTTGTATTTACAGAAAAGCTGGTCGGAACTGCTGG
AGCATACGGACACGCTGTTGGCGCAAGGCGTCAACCATCTGTGGCTGGATGTGCAGTGGTACGCCTGGCA
GGCGCTGCTGAAACTGGATGCTGACAGTGTACGGGCCGATATCCTGTGCCGAGATATGAAAGGGCTATTG
GCTCGTCTGCCGGGGCTGGAAACCCTGGCGTTTAACGATGGTACGCCATTCGCCGATGAAGTTACGCTCA
ACTGGCTTAACGAACGTGTCCTGGATGAGATGGCCGGATGGCAAGATGAGCCGGTAATGGCGGCGACCAC
CGCTGATGAGGTGCTGTCGCTGGAGCCAGAAGTGCTCACCCGCGCGGACGATGAAGGTATTGAGTCGGCG
CTGAACTGGTTACAGGCGCAGCCGGGCTATACCACCAGCCGCAATCGGTGGCTGATGCGCTTACTGATGG
CGCGGGTCAGCGAGCAGTACGGAAAAAATGAAATGGCGCTGCATCTGCTGGCGGAACTCGACAGCCGCGC
CCGGGAAATGACGCTCGAACAATGGAAGCCGGAGCTTATCTTTGAGGTCAAAGCCCGCCGACTCCGGCTG
CTCAGAGGCAAGGCCGGGCGCAGTGAGGCAGAAAAAAAATCGCTTGCTGCCAGAAATGGAGTCATTGCTT
GCCGGGCTCATCGCTCTGGATCCTGCTCGCGCCGCGGTGCTGTGCGCATAATTCACGCATCATTCACATT
GCACTCCCTGCACCTGCGGTTCTCTGCATATCTGAAAGCTATTACTCATTCTGGTGATTTATGGACGATT
TAA