SecReT6
Protein ID: 530630594
SecReT6 ID841
T6SS typei2
Gene symbol-
Locus tagN559_2917
StrainKlebsiella pneumoniae JM45
Repliconchromosome [GenBank: NC_022082] [Browse all T6SS(s) in this replicon]
Location [Strand]2971587..2971844 [-]
ProductPaaR repeat-containing protein
NotePAAR
UniProt IDS5YIA3
KEGG IDkpj:N559_2917
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 7.40E-17, Aligned region: 6..77
Protein Sequence: 85 a.a.     [Download]
>gi|530630594|ref|YP_008425862.1| PaaR repeat-containing protein [Klebsiella pneumoniae JM45]
MNKVIRKGDTLREYGGRVLMGHYQCFGLGFACKGDPVKCNKHGMTTIAEGSARTTIDGQPVALHGHRCAC
GCTLVSSNPDCGVDQ
 
Nucleotide Sequence: 258 bp     [Download]
>gi|530627845|ref|NC_022082.1|:c2971844-2971587 Klebsiella pneumoniae JM45, complete genome
ATGAATAAAGTCATTCGCAAAGGCGATACCCTGCGGGAGTATGGGGGCAGGGTGCTGATGGGGCATTATC
AGTGTTTTGGTCTGGGGTTCGCCTGCAAGGGCGACCCGGTCAAGTGTAACAAACACGGTATGACGACCAT
TGCTGAAGGCAGCGCACGAACAACGATTGATGGCCAGCCGGTTGCGCTGCACGGTCATCGCTGCGCCTGC
GGCTGCACGCTGGTCAGCTCTAACCCAGACTGCGGGGTTGATCAGTGA