SecReT6
Protein ID: 530630601
SecReT6 ID841
T6SS typei2
Gene symbol-
Locus tagN559_2924
StrainKlebsiella pneumoniae JM45
Repliconchromosome [GenBank: NC_022082] [Browse all T6SS(s) in this replicon]
Location [Strand]2976864..2979233 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDS5ZRQ2
KEGG IDkpj:N559_2924
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 6.20E-67, Aligned region: 31..352
DUF2345 [PF10106], Evalue: 2.20E-42, Aligned region: 549..563
DUF2345 [PF10106], Evalue: 2.20E-42, Aligned region: 610..756
T6SS_Vgr [PF13296], Evalue: 4.40E-34, Aligned region: 486..588
T6SS_Vgr [PF13296], Evalue: 4.40E-34, Aligned region: 625..674
Phage_base_V [PF04717], Evalue: 1.50E-16, Aligned region: 386..479
Protein Sequence: 789 a.a.     [Download]
>gi|530630601|ref|YP_008425869.1| Rhs element Vgr protein [Klebsiella pneumoniae JM45]
MKSLLFSHNHHLLSVQGCEAGLDVLAFEGDEALSQPFRYRIEFTSADHAISKEMMLMKAASLTLQAPVAQ
GFGINVQQPVRVIQGVVTGFERLGTSRDETHYALTLQPRLALLNRSHQNAIYQDQSVPQIVEKILRERHG
LRGQDFLFSLTKTYPRREQVMQYGEDDLRFITRLLGEVGIWFRFTADTRLHIDVAEFCDSQQGYEKGLTL
PSVPPSGQQSAGVDAVWEMACRHRVVEQQVSTRDYNYREATADMNAQVDVTRGETTTFGEAYHWGDNYLT
AGNVHDRHPAPESGAFYARLRHERYLNGQTRMQATTSCPTLCPGQVLKVTGGEEVAREFADGVLITAMHS
HARRDADFAVEFAGIPDSPDVGYRPEPGARPVMAGTLPARVTSTRENDTYGHIDKHGRYRVNMLFDRARW
ETGFESLWVRQSRPYAGDTYGLHLPLLAGTEVAIGFEDGNPDRPYIAGVLHDSAHGDHVTIRNDKRNVLR
TPANNKIRLDDERGKEHIKVSTEYGGKSQLNLGHLVDSDRQPRGEGFELRTDSWGAIRAQKGIFISADGQ
VQAQGQVLAMEPAVSLLKGAVNQVTEWGSITQTHHNVIPDTGPLSALTTGASDLKQPTLLMSAPQGIAAV
TPETTLLHSGKGLYLQSLGEVNITTAQRCSLNASQAISLLAQQEGMRLVSAKGPLQVESHGDILSLTALK
DITVQSTQGHLQLTAKNGITLGCGGAYIRLTPQGEIQIHGPGVISLKGQHDLQGPVSEEFPLPELPASVC
KECLKKAQALAQGFVPREA
 
Nucleotide Sequence: 2370 bp     [Download]
>gi|530627845|ref|NC_022082.1|:c2979233-2976864 Klebsiella pneumoniae JM45, complete genome
GTGAAATCGTTGTTGTTCAGCCATAACCACCACCTGCTTTCGGTGCAGGGATGTGAAGCCGGGCTTGATG
TGCTGGCCTTCGAGGGCGATGAAGCCCTGAGCCAGCCGTTCCGCTACCGTATTGAATTCACCAGCGCAGA
CCATGCCATCAGCAAAGAGATGATGCTGATGAAGGCAGCCTCCCTGACGCTGCAGGCGCCGGTGGCTCAG
GGCTTCGGCATCAATGTTCAGCAACCCGTGCGGGTGATCCAGGGCGTGGTGACGGGGTTTGAAAGGCTCG
GTACCTCCAGGGATGAAACGCACTACGCGCTGACGCTTCAGCCGCGCCTGGCGCTGCTCAACCGCTCGCA
CCAGAACGCCATTTACCAGGACCAGTCCGTTCCGCAGATTGTGGAAAAAATCCTCCGCGAGCGCCACGGC
CTGCGCGGTCAGGATTTTCTGTTCTCGCTGACAAAAACGTATCCGCGACGCGAGCAGGTGATGCAGTACG
GCGAGGATGACCTGCGCTTTATCACCCGGCTGCTGGGAGAGGTGGGGATCTGGTTTCGCTTTACCGCCGA
CACGCGGCTGCACATCGACGTCGCTGAGTTCTGCGACAGTCAGCAGGGCTATGAGAAGGGGCTGACGTTG
CCTTCGGTCCCGCCGTCAGGGCAGCAGTCGGCCGGGGTGGACGCGGTGTGGGAGATGGCATGCCGCCACC
GCGTCGTGGAGCAGCAGGTCAGTACCCGCGACTACAACTACCGCGAGGCGACGGCGGACATGAACGCGCA
GGTGGATGTCACCCGCGGGGAGACCACCACCTTTGGTGAGGCTTACCACTGGGGAGATAACTACCTGACC
GCCGGGAATGTCCATGACCGCCATCCGGCGCCGGAGTCCGGGGCGTTTTACGCCCGTCTTCGTCATGAGC
GTTATCTGAACGGCCAGACCCGGATGCAGGCCACCACCAGCTGCCCGACGCTCTGCCCGGGACAGGTGCT
GAAGGTCACCGGCGGAGAGGAGGTGGCCAGGGAGTTTGCTGATGGCGTGCTCATCACGGCGATGCACAGC
CACGCCCGGCGCGATGCCGACTTTGCGGTGGAGTTTGCCGGCATACCGGACAGCCCGGACGTCGGCTACC
GGCCTGAGCCCGGCGCGCGTCCGGTGATGGCCGGGACGCTGCCGGCCCGCGTGACCAGCACCCGGGAAAA
CGACACCTACGGGCATATCGACAAACACGGACGCTACCGGGTGAATATGTTGTTTGATCGGGCGCGCTGG
GAAACCGGGTTCGAGAGCCTGTGGGTCCGTCAGTCGCGGCCGTATGCCGGAGACACCTACGGCCTGCACC
TGCCGCTGCTGGCCGGGACGGAGGTGGCGATTGGCTTTGAGGATGGTAACCCTGACCGGCCGTATATCGC
GGGCGTGCTGCACGACTCGGCGCACGGCGACCACGTCACCATCCGCAATGACAAACGTAACGTCCTGCGC
ACCCCGGCCAACAACAAAATCCGCCTCGACGATGAGCGCGGGAAAGAACATATCAAGGTCAGCACGGAGT
ACGGCGGTAAAAGCCAGCTGAACCTGGGGCACCTGGTGGACAGTGACAGGCAGCCGCGCGGCGAAGGCTT
TGAGCTGAGAACCGACAGCTGGGGAGCTATCCGGGCACAGAAAGGGATATTTATCAGCGCGGACGGACAG
GTGCAGGCTCAGGGGCAGGTGCTGGCGATGGAGCCGGCGGTCAGTTTGCTGAAAGGTGCGGTGAATCAGG
TCACGGAATGGGGAAGCATTACGCAAACCCATCATAATGTTATCCCAGACACCGGCCCATTAAGCGCACT
GACCACAGGCGCCAGCGATCTTAAACAGCCGACATTGCTGATGTCGGCCCCGCAGGGGATTGCCGCAGTC
ACGCCGGAAACAACCCTCCTGCACAGCGGTAAGGGGCTGTATCTGCAGAGCCTGGGAGAGGTCAACATCA
CCACGGCACAGCGCTGTTCTCTGAATGCCAGCCAGGCTATTTCACTGCTGGCGCAACAGGAGGGGATGAG
GCTGGTCTCCGCCAAAGGTCCGCTGCAAGTAGAGTCGCACGGCGATATTCTATCGCTGACCGCGCTAAAA
GATATCACCGTCCAGTCAACCCAGGGGCATCTGCAGTTGACGGCTAAAAATGGCATCACCCTGGGTTGCG
GCGGCGCATATATCCGTCTTACCCCGCAGGGAGAGATACAGATCCACGGACCGGGGGTGATTAGCCTTAA
GGGGCAGCATGATTTGCAGGGGCCGGTCAGCGAGGAGTTTCCCTTGCCTGAGCTACCGGCATCGGTGTGT
AAAGAGTGCCTTAAAAAAGCCCAGGCGCTGGCGCAGGGCTTCGTGCCGCGGGAGGCATAG