SecReT6
Protein ID: 530630603
SecReT6 ID841
T6SS typei2
Gene symbol-
Locus tagN559_2926
StrainKlebsiella pneumoniae JM45
Repliconchromosome [GenBank: NC_022082] [Browse all T6SS(s) in this replicon]
Location [Strand]2982154..2982645 [-]
Producttype VI secretion system effector, Hcp1 family
NoteTssD
UniProt IDS5Z9M7
KEGG IDkpj:N559_2926
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.10E-37, Aligned region: 6..147
Protein Sequence: 163 a.a.     [Download]
>gi|530630603|ref|YP_008425871.1| type VI secretion system effector, Hcp1 family [Klebsiella pneumoniae JM45]
MAIPVYLWLKDDGGADIKGSVDVQDREGSIEVVAQEHNLYIPTDNNTGKLTGTRIHTPFLFTKEIDSSSP
YLYKAVTTGQTLKSAEFKWYRINDAGQEVEYFNTKLENVKVVKVNPLMHDIKNPAYEKHNHLEQIELRYE
KITWTYKDGNIIHSDSWNERATA
 
Nucleotide Sequence: 492 bp     [Download]
>gi|530627845|ref|NC_022082.1|:c2982645-2982154 Klebsiella pneumoniae JM45, complete genome
ATGGCAATTCCTGTTTATCTTTGGCTGAAAGACGACGGCGGCGCGGACATTAAAGGGTCTGTCGACGTTC
AGGATCGTGAAGGCAGTATCGAAGTGGTGGCTCAGGAGCATAACCTGTACATCCCGACCGATAACAACAC
CGGCAAACTGACCGGCACGCGTATTCATACGCCGTTCCTGTTCACCAAGGAGATCGACTCCTCCAGCCCC
TACCTGTACAAGGCAGTGACCACCGGCCAGACCCTGAAATCCGCTGAGTTCAAGTGGTACCGAATCAACG
ATGCCGGCCAGGAAGTGGAGTATTTCAATACCAAACTTGAGAACGTCAAGGTGGTGAAAGTGAATCCCCT
GATGCACGACATCAAAAACCCCGCCTACGAGAAGCACAACCATCTGGAACAGATTGAGCTGCGCTACGAG
AAGATCACCTGGACCTATAAAGACGGCAACATCATTCACTCCGATAGCTGGAACGAACGCGCCACCGCGT
AA