SecReT6
Protein ID: 530630604
SecReT6 ID841
T6SS typei2
Gene symbol-
Locus tagN559_2927
StrainKlebsiella pneumoniae JM45
Repliconchromosome [GenBank: NC_022082] [Browse all T6SS(s) in this replicon]
Location [Strand]2982650..2984356 [-]
ProductOmpA/MotB domain-containing protein
NoteTagL
UniProt IDS5YIB4
KEGG IDkpj:N559_2927
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 4.60E-16, Aligned region: 148..159
OmpA [PF00691], Evalue: 4.60E-16, Aligned region: 438..534
DUF4131 [PF13567], Evalue: 0.00074, Aligned region: 8..75
DUF4131 [PF13567], Evalue: 0.00074, Aligned region: 319..352
Protein Sequence: 568 a.a.     [Download]
>gi|530630604|ref|YP_008425872.1| OmpA/MotB domain-containing protein [Klebsiella pneumoniae JM45]
MSPPQQRGLALWASLLSALVCLLFLPVPRWGAWLILLVTLALIIGIWRIASRRTGRNVASTLAPLPEGAY
RQPVVLVCGDLPCVWPQASPVRVVKQGCWIRVEKTEELQQVARQVLSQRPEWGPQLSVLLCVCPQRHAQS
DALTSALLALRWQLSQLRQQTGYAVPLVLQGQVGSAMSRDLLWQAAIPGEAVKVWQPSCAPCSVPAWVSA
GGAAALEQQVLMNSLMGWFEQHVHAVLTEENTDLPPLTPAAVLWGLGPSLPGRLASSAWTTWLSRHSGLS
RVAGWQPDESDTGDASALPELILPQLPVGRGLTPRGRAWRAALAIFTLAAVAALLSSGWNNRQLLQRVSV
DIARYERIAMDDYRPKASAVRVLREDAALLDSWARNGVPLRLSLGLYHGEQIRLPLLEAIRGYVPPPPPP
RPVQRVAPDVIRLDSMSLFDTGKWVLKPGSTKRLVSSLMDIKARPGWLIVVAGHTDSVGEEKANQLLSLK
RAESVRDWMRDTGDVPDSCFAVQGYGESRPIATNDTPEGRALNRRVEISLVPQVDACRLPDQPSASSQDD
GASLHNGE
 
Nucleotide Sequence: 1707 bp     [Download]
>gi|530627845|ref|NC_022082.1|:c2984356-2982650 Klebsiella pneumoniae JM45, complete genome
ATGAGCCCCCCGCAGCAGCGTGGGCTGGCGCTGTGGGCCAGTCTGCTGAGTGCGCTGGTGTGCCTGCTAT
TTTTGCCGGTTCCCCGCTGGGGGGCGTGGCTCATTCTGCTGGTCACGCTGGCCCTGATCATCGGGATCTG
GCGCATCGCCAGTCGTCGTACCGGACGTAACGTCGCATCAACCCTGGCCCCTCTCCCGGAGGGCGCTTAT
CGCCAACCGGTGGTCCTCGTTTGCGGCGACCTGCCGTGTGTCTGGCCGCAAGCGTCACCGGTGCGAGTGG
TCAAACAGGGCTGCTGGATCCGCGTGGAAAAGACGGAGGAGCTGCAGCAGGTCGCGCGCCAGGTATTGAG
CCAGCGGCCGGAATGGGGGCCTCAGCTGTCGGTGCTGCTCTGCGTCTGCCCGCAGCGGCATGCGCAAAGC
GATGCGCTGACCAGCGCTCTGCTGGCCCTGCGCTGGCAACTCAGCCAGCTGCGCCAGCAGACGGGGTATG
CCGTACCGCTGGTGCTGCAGGGGCAGGTGGGCAGCGCGATGAGTCGCGACCTGTTGTGGCAGGCGGCGAT
ACCGGGTGAAGCGGTGAAAGTCTGGCAGCCCTCCTGCGCCCCCTGTTCCGTACCGGCCTGGGTAAGCGCC
GGTGGGGCGGCCGCGCTGGAGCAGCAGGTGCTGATGAACAGCCTGATGGGCTGGTTTGAACAGCACGTCC
ATGCCGTGTTGACGGAAGAGAATACCGACCTGCCACCTCTGACCCCTGCGGCCGTGCTGTGGGGCCTCGG
GCCCTCGCTGCCTGGAAGGCTGGCATCGTCGGCCTGGACGACGTGGTTATCCCGACATAGCGGCCTGTCG
CGGGTAGCTGGCTGGCAGCCAGATGAGAGCGACACCGGGGACGCTTCAGCTTTGCCGGAATTAATCCTGC
CGCAGTTACCGGTGGGACGGGGACTCACGCCACGAGGCAGGGCCTGGCGAGCGGCGCTCGCGATTTTCAC
CCTCGCGGCTGTCGCCGCGCTGCTCAGCAGTGGCTGGAACAATCGACAACTGCTGCAGCGCGTGAGCGTC
GATATTGCCCGTTATGAGCGGATTGCGATGGATGATTATCGACCAAAAGCCAGCGCTGTCAGGGTGCTGC
GTGAAGATGCCGCGCTGCTTGATAGCTGGGCGCGTAACGGCGTCCCGCTGCGCCTGAGTCTGGGCTTGTA
TCACGGGGAGCAGATTCGCCTGCCGTTGCTGGAGGCGATTCGCGGTTACGTGCCGCCTCCGCCTCCGCCC
AGGCCGGTGCAGCGCGTCGCGCCGGATGTCATCCGCCTTGACAGCATGTCGCTATTCGATACCGGGAAAT
GGGTACTGAAGCCTGGTTCGACAAAGCGGCTGGTCAGCTCGCTGATGGACATTAAGGCCAGGCCCGGGTG
GCTGATCGTGGTGGCGGGTCACACCGACAGCGTGGGTGAGGAAAAAGCCAACCAGCTATTGTCGCTGAAA
CGTGCGGAATCGGTCCGCGACTGGATGCGCGATACCGGCGACGTGCCGGACAGCTGCTTTGCCGTTCAGG
GCTATGGCGAAAGCCGACCAATTGCAACAAACGATACGCCGGAAGGCCGTGCGCTGAACCGTCGTGTCGA
AATCAGTCTGGTGCCGCAGGTAGACGCCTGCCGGTTACCGGACCAACCCTCTGCGTCATCCCAGGATGAT
GGCGCTTCACTACACAATGGAGAGTAA