SecReT6
Protein ID: 530630607
SecReT6 ID841
T6SS typei2
Gene symbol-
Locus tagN559_2930
StrainKlebsiella pneumoniae JM45
Repliconchromosome [GenBank: NC_022082] [Browse all T6SS(s) in this replicon]
Location [Strand]2986392..2987978 [-]
ProductEvpB/family type VI secretion protein
NoteTssC
UniProt IDS5YPV2
KEGG IDkpj:N559_2930
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.30E-171, Aligned region: 102..524
Protein Sequence: 528 a.a.     [Download]
>gi|530630607|ref|YP_008425875.1| EvpB/family type VI secretion protein [Klebsiella pneumoniae JM45]
MRGKSVNGLTGKMLMSVTTENAPVQGQTTLQENRAGEGVYASLFEKINLTPASRLGDINDFLDDAALSEA
PAAERLTAAMQVFMERIRQSGQRVEKLDKTLIDHHIAELDFQISRQLDAVMHHQEFQQVESLWRGLKQLV
DNTDYRQNVKTEILDVAKDDLRQDFEDAPELIQSGMYWHTYTAEYDTPGGEPIGSVISAYEFDASPQDVA
LLRNISRVSAAAHMPFIGAVGPAFFLKETMEEVAAIKDIGNYFDRAEYIRWKAFRETDDARYIGLVMPRV
LGRLPYGPDTVPVRSFNYVEQVKGPDHEKYLWTSAAFSFASNMVKSFVNNGWCVQIRGPQAGGAVKDLPI
HLYDLGTGNQVKIPSEVMIPETREFEFASLGFIPLSYYKNRDYACFFSANSAQKPALYDTADATANSRIN
ARLPYIFLLSRIAHYLKMIQRENIGTTKDRRLLELELNTWVRSLVTEMTDPGDELQASHPLRDASVVVED
IEDNPGFFRVKLYAVPHFQVEGMDVNLSLVSQMPKAKA
 
Nucleotide Sequence: 1587 bp     [Download]
>gi|530627845|ref|NC_022082.1|:c2987978-2986392 Klebsiella pneumoniae JM45, complete genome
GTGCGGGGCAAGTCTGTTAATGGATTAACCGGGAAAATGCTAATGTCTGTTACCACAGAAAACGCCCCTG
TTCAGGGGCAAACCACGCTGCAGGAAAACAGGGCGGGCGAGGGCGTTTACGCCTCGCTGTTTGAAAAAAT
TAATCTCACCCCGGCGTCTCGCCTCGGGGATATCAACGACTTTCTGGACGATGCCGCGCTCTCCGAGGCG
CCGGCGGCGGAACGTCTCACCGCGGCGATGCAGGTGTTTATGGAACGCATCCGCCAGTCCGGCCAGCGGG
TGGAAAAGCTCGACAAAACGCTGATCGATCACCATATCGCCGAGCTGGATTTCCAGATAAGCCGTCAGCT
GGACGCGGTGATGCACCATCAGGAGTTTCAGCAGGTCGAATCCCTGTGGCGCGGCCTCAAACAGCTGGTG
GACAACACCGACTATCGGCAGAACGTCAAAACGGAGATCCTCGACGTCGCCAAAGACGATCTGCGCCAGG
ACTTTGAGGACGCGCCGGAGCTTATCCAGAGCGGCATGTACTGGCACACCTATACCGCGGAGTATGACAC
TCCCGGCGGCGAGCCGATCGGCTCGGTGATCTCGGCCTATGAGTTCGACGCCAGCCCGCAGGATGTGGCG
CTGCTGCGCAATATCTCCCGCGTCTCTGCGGCCGCCCATATGCCGTTTATCGGCGCCGTCGGCCCGGCCT
TCTTCCTGAAAGAGACCATGGAAGAGGTGGCTGCCATTAAGGATATCGGCAACTACTTCGATCGTGCGGA
ATATATCCGCTGGAAGGCGTTTCGCGAAACTGACGATGCCCGCTACATCGGCCTGGTGATGCCGCGCGTG
CTGGGTCGTCTGCCGTACGGTCCGGACACCGTGCCGGTGCGCAGCTTCAACTATGTCGAGCAGGTGAAGG
GCCCGGATCACGAAAAATATCTCTGGACCAGCGCGGCGTTCTCCTTCGCATCTAATATGGTGAAGAGCTT
TGTTAACAACGGCTGGTGCGTGCAAATTCGCGGTCCGCAGGCGGGCGGCGCGGTGAAAGATTTGCCTATC
CATCTGTACGATCTGGGCACCGGCAACCAGGTGAAGATCCCTTCCGAGGTGATGATCCCGGAAACGCGGG
AGTTTGAGTTCGCCAGCCTGGGCTTTATCCCGCTGTCGTACTACAAAAATCGCGATTACGCCTGCTTCTT
CTCGGCCAACTCCGCGCAGAAACCGGCGCTGTACGATACCGCCGACGCCACCGCCAACAGCCGTATCAAC
GCGCGTCTGCCTTACATCTTCCTGCTGTCGCGCATCGCGCACTACCTGAAGATGATCCAGCGCGAAAATA
TCGGCACCACCAAGGACCGGCGTCTGCTGGAGCTGGAGCTGAACACCTGGGTGCGGAGCCTGGTGACCGA
AATGACCGACCCCGGCGACGAGCTGCAGGCCTCCCATCCGCTGCGCGATGCCAGCGTGGTGGTGGAAGAT
ATCGAGGATAACCCGGGCTTCTTCCGCGTGAAGCTGTACGCGGTGCCGCACTTCCAGGTCGAGGGGATGG
ACGTCAATCTGTCGCTGGTTAGCCAGATGCCAAAGGCGAAGGCGTAG