SecReT6
Protein ID: 530630608
SecReT6 ID841
T6SS typei2
Gene symbol-
Locus tagN559_2931
StrainKlebsiella pneumoniae JM45
Repliconchromosome [GenBank: NC_022082] [Browse all T6SS(s) in this replicon]
Location [Strand]2987979..2988557 [-]
Producthypothetical protein
NoteTssB
UniProt IDS5Z9N1
KEGG IDkpj:N559_2931
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.50E-52, Aligned region: 35..187
Protein Sequence: 192 a.a.     [Download]
>gi|530630608|ref|YP_008425876.1| hypothetical protein N559_2931 [Klebsiella pneumoniae JM45]
MIGNPFLLYHRHVSHQYIFNNYSLRKGTAMADTFQNEVPRARINLKLSLHTGGAQKKVELPLKLLTIGDF
SHVKENRPLSEREKINVNKNNFNSVLSEFSPEVNLSVPNTLAGNGEEENVRLRFTDIKDFEPEQVARQIP
QLRAMLAMRNLLRDLKSNLLDNATFRKELEAILKDPALSQELRDEMSALAPK
 
Nucleotide Sequence: 579 bp     [Download]
>gi|530627845|ref|NC_022082.1|:c2988557-2987979 Klebsiella pneumoniae JM45, complete genome
TTGATCGGTAATCCATTTTTGCTTTATCATCGTCACGTTTCACATCAATATATCTTCAATAATTATTCCT
TAAGGAAAGGAACTGCTATGGCTGATACGTTCCAGAATGAAGTCCCCAGGGCGCGCATTAATCTCAAATT
ATCTCTTCATACCGGCGGCGCGCAAAAGAAGGTCGAACTGCCGCTCAAACTGCTTACCATTGGCGATTTT
AGTCATGTTAAGGAAAACCGGCCTTTATCGGAAAGAGAAAAAATCAACGTCAATAAAAATAATTTTAACA
GCGTACTTTCGGAATTTAGCCCGGAAGTTAACCTCTCGGTGCCGAATACGCTGGCCGGCAATGGCGAAGA
GGAGAACGTCAGACTGCGTTTTACCGACATCAAAGATTTTGAACCGGAGCAGGTTGCCCGGCAAATTCCG
CAACTCCGCGCCATGCTGGCGATGCGTAATTTATTACGCGATCTCAAATCCAATCTGCTCGATAACGCCA
CTTTCAGAAAAGAGCTTGAGGCAATCCTGAAAGATCCGGCGCTGTCCCAGGAATTACGCGACGAAATGAG
TGCGCTTGCCCCGAAATAA