SecReT6
Protein ID: 53713225
SecReT6 ID908
T6SS typeiii
Gene symbol-
Locus tagBF1935
StrainBacteroides fragilis YCH46
Repliconchromosome [GenBank: NC_006347] [Browse all T6SS(s) in this replicon]
Location [Strand]2277219..2278112 [-]
Producthypothetical protein
NoteTssP
UniProt IDQ64UZ6
KEGG IDbfr:BF1935
PDB IDNA
Domain hit(s) vs Pfam PKD [PF00801], Evalue: 7.50E-13, Aligned region: 42..98
PKD [PF00801], Evalue: 7.50E-13, Aligned region: 143..179
Protein Sequence: 297 a.a.     [Download]
>gi|53713225|ref|YP_099217.1| hypothetical protein BF1935 [Bacteroides fragilis YCH46]
MMNKFLNTKVLYIFISVIILIMVFLLVMRACSQKQPIQATVTPSDPVVGEEIFFSDSTSGARIWYWEFGN
NETSTQRSGHHRFKQKGVYKIRLTVNGNLERYFDVRVKEKTNTEDLHLVHIIAPKEAIQGENIIFRGEGH
DEQWRWEFGETGMIDSREKTALYAYTEPGEYEVLLNTENTRYPIRHRINILPYYSENDSTDVMVLIGLDI
KEKLQNIADGKPFNVNYNYVVDKYFNNNPNTLVIVNNNKYNDFYSYCQGLHHIGRKETIIQNVIVETEDE
ESGYITQITVMQIEKKK
 
Nucleotide Sequence: 894 bp     [Download]
>gi|53711291|ref|NC_006347.1|:c2278112-2277219 Bacteroides fragilis YCH46 chromosome, complete genome
ATGATGAATAAATTCCTAAATACGAAGGTTCTCTATATCTTTATCTCCGTTATCATACTTATTATGGTTT
TTCTGCTGGTAATGAGAGCTTGCTCGCAGAAGCAGCCGATTCAGGCTACTGTAACTCCGTCTGACCCTGT
CGTGGGGGAAGAAATATTTTTTTCCGATTCCACATCGGGAGCGAGAATCTGGTACTGGGAGTTCGGAAAC
AACGAGACATCCACACAACGCAGCGGACACCATCGGTTCAAGCAAAAAGGGGTGTACAAAATACGACTGA
CCGTCAACGGAAATCTGGAACGCTACTTTGATGTGAGGGTAAAAGAGAAGACCAATACGGAAGACCTGCA
TCTGGTTCATATCATAGCTCCCAAGGAAGCCATTCAGGGAGAAAATATCATCTTCCGTGGCGAAGGACAC
GACGAACAATGGCGCTGGGAGTTCGGAGAGACGGGGATGATTGATTCCCGTGAAAAAACGGCTCTTTATG
CTTATACCGAACCCGGAGAGTACGAAGTATTGCTTAATACGGAGAATACCCGGTATCCCATCAGACACCG
GATAAACATTCTGCCCTACTATTCGGAGAATGATTCTACCGATGTAATGGTGCTCATCGGTTTAGACATC
AAAGAGAAGTTGCAGAACATTGCAGACGGTAAACCCTTTAATGTAAACTACAACTATGTCGTGGACAAGT
ATTTTAATAATAACCCGAACACGCTGGTTATTGTCAACAACAATAAATATAACGACTTTTATTCTTATTG
CCAAGGACTGCACCATATCGGCAGAAAAGAAACGATTATCCAGAATGTCATCGTAGAGACGGAGGATGAA
GAGAGCGGATATATTACCCAAATAACGGTTATGCAAATCGAAAAAAAGAAATGA