SecReT6
Protein ID: 53713228
SecReT6 ID908
T6SS typeiii
Gene symbol-
Locus tagBF1938
StrainBacteroides fragilis YCH46
Repliconchromosome [GenBank: NC_006347] [Browse all T6SS(s) in this replicon]
Location [Strand]2279158..2280114 [-]
Producthypothetical protein
NoteTssG
UniProt IDQ64UZ3
KEGG IDbfr:BF1938
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.40E-10, Aligned region: 177..316
Protein Sequence: 318 a.a.     [Download]
>gi|53713228|ref|YP_099220.1| hypothetical protein BF1938 [Bacteroides fragilis YCH46]
MEHRLPKEIKGLLPPNTMDTDFKAELYGALLAEAGFDTAQIMMVRDGNNLSNVSKDIRSVKYRNHVGIAE
GTYIELKTNRRGIYDSLPEGLFHEALFPGKVKDLGLILEEMQQHSNEEFFIRRFFSLLESEVDREGIQAQ
LLELRYDKKNKYSDYAKLFAACWPVIHILSGQGALLFIKFMPHIHSIRGRLEEVSDALSQILEAPVKVRP
KMVQRTIRAQKPNRLGNMRLGANSVNVGVLNSAEADLHIHISDLPTREVERFLPGNRSRKALEMLADIFL
GAWQEFDVTVSVSPDERKTYLKPTGDASPCYLGINTYL
 
Nucleotide Sequence: 957 bp     [Download]
>gi|53711291|ref|NC_006347.1|:c2280114-2279158 Bacteroides fragilis YCH46 chromosome, complete genome
ATGGAACATCGCTTACCCAAAGAGATAAAGGGGCTTCTTCCGCCCAATACAATGGACACCGACTTCAAGG
CAGAGCTATACGGAGCCTTGCTAGCGGAAGCCGGGTTCGACACCGCTCAAATTATGATGGTGCGTGACGG
TAATAACCTGAGCAATGTTTCGAAAGATATCCGATCGGTGAAGTACAGAAATCATGTCGGCATAGCGGAG
GGGACATACATAGAACTAAAGACCAACCGCCGGGGGATTTATGATTCGCTGCCGGAGGGATTGTTCCATG
AGGCGCTCTTTCCCGGCAAGGTGAAAGATTTGGGACTTATTCTGGAAGAGATGCAACAACATAGTAACGA
AGAGTTCTTTATCCGCCGTTTTTTCAGCCTGCTGGAGAGCGAAGTGGACAGAGAAGGGATACAGGCACAA
TTGCTCGAATTGCGGTACGATAAAAAGAACAAATATTCTGATTATGCGAAACTCTTTGCCGCTTGCTGGC
CGGTCATTCATATTTTGTCCGGACAGGGGGCGTTGCTGTTCATCAAGTTCATGCCGCATATCCATTCGAT
CCGGGGCAGACTGGAAGAGGTAAGCGACGCACTGTCGCAGATTCTGGAAGCTCCAGTAAAGGTACGCCCG
AAAATGGTGCAACGGACAATAAGGGCGCAAAAACCGAACCGGTTGGGGAACATGAGACTGGGAGCAAACA
GTGTGAATGTGGGGGTGCTTAATAGTGCGGAAGCTGATTTGCATATACACATAAGCGACCTGCCAACACG
GGAAGTCGAAAGGTTCCTGCCCGGCAACCGCTCCCGCAAAGCTCTTGAAATGCTGGCGGATATTTTTCTT
GGCGCGTGGCAGGAGTTCGATGTGACGGTCAGCGTTAGCCCTGACGAACGCAAGACTTATTTAAAACCGA
CGGGTGACGCCAGTCCGTGTTACCTCGGGATAAACACTTATTTATAA