SecReT6
Protein ID: 53713229
SecReT6 ID908
T6SS typeiii
Gene symbol-
Locus tagBF1939
StrainBacteroides fragilis YCH46
Repliconchromosome [GenBank: NC_006347] [Browse all T6SS(s) in this replicon]
Location [Strand]2280116..2281258 [-]
Producthypothetical protein
NoteTssK
UniProt IDQ64UZ2
KEGG IDbfr:BF1939
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 0.00016, Aligned region: 163..209
Protein Sequence: 380 a.a.     [Download]
>gi|53713229|ref|YP_099221.1| hypothetical protein BF1939 [Bacteroides fragilis YCH46]
MAKKNLVNWSDCMPLSAAIFNQHDDYFLNSIRDSIEVRTNSYNYGLLPARQNRDGENGIRISQHVTGHIE
VRLKYCDAVTASGIRIQFDATETGSELVKNYSVESDTRKNITQWDIILSVDPFHRVGSGDPNPEEVPPRH
PNALPSYRLFVMPKGEINISELGSHYLTIGRIRKDAERFMVDADFIPPCTTMKSHPELQEYHAKFGNMFR
SLENYSKIIIAKIHNRDNRGKLGAHISLICREMLRYLATLQFTYTNKGLYNAPIDVLEAVSSLAHIMYVS
FSYLSGTQKEETQKYFYEWSDVTPGSFDEQLADTLEMLYEHTDIRASMVRAYSFMYTLTELWQRLSTLEY
IGQHKENIVVSERTTGNNTTGQNKTWSIMD
 
Nucleotide Sequence: 1143 bp     [Download]
>gi|53711291|ref|NC_006347.1|:c2281258-2280116 Bacteroides fragilis YCH46 chromosome, complete genome
ATGGCAAAGAAAAATTTAGTGAACTGGTCGGACTGTATGCCGCTGTCAGCCGCCATCTTCAACCAACATG
ACGATTACTTTCTGAACAGCATTCGCGACAGCATAGAAGTACGAACCAACAGTTATAACTACGGGCTGTT
GCCCGCACGGCAAAACAGGGATGGCGAAAACGGCATCCGTATCAGCCAGCACGTGACCGGACACATCGAA
GTGCGGCTGAAATACTGCGATGCGGTCACCGCTTCGGGTATCCGCATCCAATTTGATGCCACCGAAACGG
GAAGCGAATTAGTGAAGAACTATTCTGTAGAATCGGATACCCGTAAGAATATCACGCAATGGGACATTAT
CCTCTCCGTGGATCCGTTCCACCGGGTAGGCTCGGGTGACCCCAATCCGGAGGAAGTTCCACCCCGCCAT
CCGAACGCCTTGCCCTCCTATCGGCTGTTTGTGATGCCTAAAGGAGAAATCAATATCAGTGAACTGGGTT
CCCATTACCTGACCATCGGACGTATCCGCAAGGATGCCGAACGATTCATGGTAGATGCCGACTTTATCCC
GCCCTGTACGACGATGAAAAGCCACCCTGAACTGCAAGAGTATCATGCCAAGTTCGGAAATATGTTCCGC
TCACTGGAGAATTACAGCAAAATTATCATAGCCAAAATACATAACAGGGATAATCGCGGCAAACTGGGTG
CGCACATCTCTCTGATATGTCGGGAGATGCTCCGCTACCTCGCCACCCTGCAATTCACTTATACCAATAA
AGGGCTGTACAATGCTCCTATAGACGTATTGGAAGCCGTATCGAGTCTGGCGCATATCATGTATGTAAGT
TTCAGCTACCTATCAGGGACGCAAAAGGAGGAAACACAGAAATATTTCTACGAATGGAGCGACGTGACGC
CCGGTTCGTTCGACGAGCAACTCGCCGATACGCTGGAGATGCTGTACGAACATACGGATATCCGGGCTTC
GATGGTTCGTGCCTATTCGTTTATGTACACGCTTACCGAATTGTGGCAACGGCTCAGTACGCTGGAATAT
ATCGGTCAGCATAAGGAGAATATTGTGGTATCGGAACGCACAACGGGAAACAATACTACGGGACAAAACA
AAACATGGAGCATAATGGATTGA