SecReT6
Protein ID: 53713230
SecReT6 ID908
T6SS typeiii
Gene symbol-
Locus tagBF1940
StrainBacteroides fragilis YCH46
Repliconchromosome [GenBank: NC_006347] [Browse all T6SS(s) in this replicon]
Location [Strand]2281286..2282134 [-]
Producthypothetical protein
NoteTssN
UniProt IDQ64UZ1
KEGG IDbfr:BF1940
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 282 a.a.     [Download]
>gi|53713230|ref|YP_099222.1| hypothetical protein BF1940 [Bacteroides fragilis YCH46]
MDSFFQTLAFTYLLYPILGLLLVGLGIFIAKKNALLNNKRLVGYTIGAIAILTLPALLGFLDYGFMPYGY
IFLAMLYLLLGSYNIRMIAWVFKDDYKYRHEIILTSFILVVSMLFFTLVFNLCNELKYGLWASTCLLPFV
IVSVFIRTYRIFIAIPIPVYEVWRYTDDTEQEGYFDPGSLQVLQIELYKQESDREPVKLSVKAPDEMQFG
TWFHRMIDDYNLKSPQAPIDDYAAKEGGWIFYRKPTLLSPRHYIDFNLTVKDNRIRSRDVIVAKRVMEQS
EN
 
Nucleotide Sequence: 849 bp     [Download]
>gi|53711291|ref|NC_006347.1|:c2282134-2281286 Bacteroides fragilis YCH46 chromosome, complete genome
ATGGACTCTTTTTTCCAGACCCTCGCCTTCACATATCTGCTCTACCCGATATTGGGATTGTTACTGGTAG
GCTTAGGCATTTTCATAGCCAAGAAAAACGCTCTGCTGAACAACAAGCGGCTGGTAGGCTACACTATCGG
TGCAATTGCCATCCTGACGCTCCCTGCTTTGTTGGGATTCCTTGATTACGGTTTCATGCCCTACGGCTAC
ATCTTCCTTGCCATGCTGTATCTCCTTCTGGGCAGTTATAACATACGAATGATTGCGTGGGTTTTTAAGG
ACGACTACAAGTACCGCCACGAAATCATACTCACCAGTTTTATACTGGTGGTATCCATGTTGTTCTTCAC
CCTTGTCTTCAATCTCTGCAATGAATTGAAATACGGTCTGTGGGCATCCACCTGCCTGCTTCCATTCGTC
ATTGTCTCGGTATTTATCCGCACCTACCGTATCTTTATCGCCATTCCGATTCCCGTGTATGAAGTATGGA
GATACACAGACGATACCGAGCAGGAGGGATATTTTGACCCGGGCAGCCTGCAAGTTCTGCAAATAGAGCT
ATACAAGCAAGAAAGCGACCGGGAACCGGTCAAACTCAGTGTGAAAGCACCGGACGAAATGCAATTTGGC
ACATGGTTCCACCGGATGATTGACGACTATAATCTGAAATCTCCGCAAGCCCCGATAGACGACTATGCAG
CAAAAGAGGGAGGATGGATTTTCTACCGGAAACCCACCTTGCTATCTCCCCGGCATTACATAGACTTCAA
CCTTACCGTAAAGGACAACCGCATCCGCAGCCGTGATGTAATTGTCGCTAAACGGGTGATGGAACAGAGT
GAGAATTAA