SecReT6
Protein ID: 53713235
SecReT6 ID908
T6SS typeiii
Gene symbol-
Locus tagBF1945
StrainBacteroides fragilis YCH46
Repliconchromosome [GenBank: NC_006347] [Browse all T6SS(s) in this replicon]
Location [Strand]2288771..2290588 [-]
Producthypothetical protein
NoteTssF
UniProt IDQ64UY6
KEGG IDbfr:BF1945
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 605 a.a.     [Download]
>gi|53713235|ref|YP_099227.1| hypothetical protein BF1945 [Bacteroides fragilis YCH46]
MANLFTKESIKARMFKQAATLYDIRNIDGIDPLIRLLIEALSGEIFKLSGDMHAIESRLLEKVASALTPH
TALVAKPAHAIAAARPYTPQATVSPTDLFSYKSTEIVKKYKMKNLFFTPLHETRIINAELKFLVTADEFC
TITPEGERDATARFRSDVPVMGRKISIGMKIGNNVTTLNDLPLYIDIPLVADKSSYLKLLPYCHCTIAGI
PVEIKGGIEYAPTRSVSEKYDLGRLITEEITSKYASHYLTLKAHGLKVRDLSRSRVPEEISFLLPSDFIA
ECDADTVWIDIEFPTAFSKEILEQIKVQMNTFIVVNKYPAKITRKVDSVSAILPLEKTEFEYFLFVDSIT
DNHGDRLREISGTQDEGRAGCYSVRRGGCERFNAMDAKDFLNRLTDLLYDESMAFSSTDKDGMKEVIEQI
EERVSQLGDKNKDGVGGQEMLSYVVIDQRYDKDTRLTVDYTLTNGEFANDIYAGEPLNDCANPDIDKDTL
RFVTSAHGGEPSPSVKRRMDMYRFMLLSHGSIYTKEDIRNFCMARYGDSIRSVEVKLGYAAGKKESEGFI
RTLDVYLRLSEGMQGLDRDEFVVDLDSELRRLSPETYNYRVFINS
 
Nucleotide Sequence: 1818 bp     [Download]
>gi|53711291|ref|NC_006347.1|:c2290588-2288771 Bacteroides fragilis YCH46 chromosome, complete genome
ATGGCAAATCTATTCACAAAAGAAAGCATTAAAGCCCGGATGTTCAAACAGGCGGCAACCCTATATGACA
TACGAAATATAGATGGCATAGACCCCCTTATCCGACTGCTGATTGAAGCCTTGTCGGGCGAAATTTTCAA
GCTGTCCGGTGATATGCACGCCATTGAAAGCCGATTGTTGGAGAAAGTCGCTTCCGCCCTTACTCCACAC
ACGGCATTGGTTGCCAAACCCGCCCATGCTATTGCTGCTGCCCGACCATATACACCGCAAGCTACTGTAT
CTCCCACAGACCTGTTTTCTTATAAAAGCACGGAGATAGTGAAGAAGTATAAGATGAAAAATCTCTTCTT
TACTCCGCTGCATGAAACCCGCATAATCAATGCCGAACTGAAGTTTCTCGTGACGGCGGATGAATTTTGC
ACAATCACTCCCGAAGGAGAACGTGACGCCACTGCCCGCTTTCGTTCCGATGTGCCGGTAATGGGTCGGA
AAATCAGTATCGGGATGAAAATAGGCAACAATGTAACTACCCTCAACGACTTGCCGTTATATATAGATAT
ACCGCTTGTAGCAGATAAAAGCAGTTATCTGAAATTACTGCCGTACTGCCATTGCACGATTGCCGGTATT
CCTGTAGAAATTAAAGGGGGAATCGAGTACGCCCCCACACGTTCGGTCAGTGAGAAATACGATCTTGGCA
GGTTGATTACGGAAGAAATAACCAGCAAATATGCTTCCCATTACCTGACATTGAAAGCTCACGGATTAAA
AGTCAGAGATTTGTCACGTAGCAGAGTGCCCGAAGAAATCTCTTTCCTGCTGCCAAGTGATTTCATTGCT
GAATGTGATGCGGATACTGTTTGGATAGATATAGAATTTCCCACCGCTTTTTCAAAAGAAATACTGGAAC
AGATAAAGGTGCAGATGAACACTTTTATCGTAGTAAACAAATATCCGGCAAAGATTACCAGAAAGGTAGA
TTCCGTCTCGGCCATTCTCCCTTTGGAAAAGACGGAATTTGAATATTTCCTGTTTGTGGATTCGATTACC
GATAACCACGGAGACCGGCTTAGGGAAATTTCCGGCACACAGGATGAAGGTAGGGCCGGCTGTTATTCGG
TCAGAAGGGGCGGTTGCGAACGCTTCAATGCGATGGATGCCAAAGATTTTCTGAACCGCCTGACAGACCT
GCTATATGACGAAAGCATGGCCTTCTCTTCGACAGACAAAGACGGAATGAAAGAGGTAATCGAGCAGATA
GAAGAACGGGTAAGCCAATTGGGAGATAAAAATAAAGACGGAGTCGGAGGACAGGAAATGTTGTCGTATG
TAGTCATAGACCAACGTTATGACAAGGATACCCGGTTAACTGTGGATTATACTCTTACTAATGGCGAATT
TGCCAATGACATCTATGCGGGAGAGCCATTAAATGACTGTGCTAATCCCGATATAGACAAAGATACACTG
CGGTTTGTCACTTCCGCCCATGGAGGAGAGCCCTCCCCATCCGTAAAGCGCCGGATGGATATGTACCGAT
TCATGCTGTTGTCACACGGCAGTATATACACGAAAGAGGATATACGCAATTTCTGCATGGCAAGGTATGG
CGACAGCATCCGCTCTGTGGAGGTAAAGCTGGGGTATGCAGCCGGTAAAAAAGAAAGCGAAGGTTTCATA
AGGACGCTGGACGTGTATCTACGGCTATCGGAGGGGATGCAAGGATTAGACCGGGACGAATTCGTCGTTG
ATTTGGACAGTGAGCTCAGGCGGTTGTCTCCGGAAACCTATAACTACCGTGTTTTTATTAACTCATAG