SecReT6
Protein ID: 53713236
SecReT6 ID908
T6SS typeiii
Gene symbol-
Locus tagBF1946
StrainBacteroides fragilis YCH46
Repliconchromosome [GenBank: NC_006347] [Browse all T6SS(s) in this replicon]
Location [Strand]2290619..2291059 [-]
Producthypothetical protein
NoteTssE
UniProt IDQ64UY5
KEGG IDbfr:BF1946
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 9.90E-18, Aligned region: 24..128
Protein Sequence: 146 a.a.     [Download]
>gi|53713236|ref|YP_099228.1| hypothetical protein BF1946 [Bacteroides fragilis YCH46]
MKQKYYKLPVRLEKLFEGDTRQLERCSELESIDQHIELLLTTYPGEHRFDPKYGCRIWELDFERIVSTEQ
WKELFTGYVMQAISTYEKRISDITLSVNLQEVVREEVLDNRMIRKRVDITVLATLNSTGAPCGFGYKLYM
GPLSNE
 
Nucleotide Sequence: 441 bp     [Download]
>gi|53711291|ref|NC_006347.1|:c2291059-2290619 Bacteroides fragilis YCH46 chromosome, complete genome
ATGAAACAGAAATACTATAAACTACCGGTACGTTTGGAAAAGCTCTTCGAAGGAGATACCCGGCAACTGG
AAAGATGTTCCGAACTGGAATCCATCGATCAGCACATCGAACTGTTGCTGACCACCTATCCGGGTGAGCA
CCGTTTCGACCCCAAATACGGTTGTCGGATTTGGGAGTTGGACTTTGAGCGCATTGTTTCTACCGAACAA
TGGAAAGAACTGTTTACCGGATACGTGATGCAGGCGATTTCCACTTATGAGAAACGCATTTCCGACATCA
CTCTCTCGGTAAACCTACAAGAAGTCGTCAGGGAAGAAGTTCTGGATAACCGGATGATACGTAAGCGGGT
AGATATTACAGTACTCGCCACATTGAATTCCACCGGTGCTCCCTGCGGTTTCGGTTACAAATTATACATG
GGACCTTTATCAAACGAATAA