SecReT6
Protein ID: 53713238
SecReT6 ID908
T6SS typeiii
Gene symbol-
Locus tagBF1948
StrainBacteroides fragilis YCH46
Repliconchromosome [GenBank: NC_006347] [Browse all T6SS(s) in this replicon]
Location [Strand]2291519..2291938 [-]
Producthypothetical protein
NoteHcp
UniProt IDQ64UY3
KEGG IDbfr:BF1948
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 139 a.a.     [Download]
>gi|53713238|ref|YP_099230.1| hypothetical protein BF1948 [Bacteroides fragilis YCH46]
MGFFDRLFKGKEVFADRRNPDMVCEITLCGQSHILSEFDIAYEPDNSSKEYMEAYAVFSEPVNAEVENWI
MRADRKENGTVRFYLNSDAMDEGALFEINFSNASCVHYHNVSQGDTSVKTIVMTFPSVRMGGDEFELKR
 
Nucleotide Sequence: 420 bp     [Download]
>gi|53711291|ref|NC_006347.1|:c2291938-2291519 Bacteroides fragilis YCH46 chromosome, complete genome
ATGGGCTTTTTCGACAGGCTGTTTAAAGGAAAAGAAGTGTTTGCGGATAGACGCAATCCGGATATGGTAT
GCGAGATAACGCTTTGCGGGCAGTCGCACATCTTGTCCGAGTTTGATATTGCCTATGAGCCGGATAATTC
CTCGAAAGAATATATGGAAGCATACGCCGTATTTTCAGAGCCGGTGAATGCGGAGGTAGAAAACTGGATA
ATGAGAGCGGACAGGAAAGAAAACGGGACAGTCCGATTCTATCTCAACAGCGATGCTATGGACGAAGGTG
CACTGTTCGAGATAAATTTCAGTAATGCGAGCTGCGTGCATTATCACAATGTATCGCAGGGAGACACATC
GGTAAAGACCATTGTGATGACTTTTCCGTCTGTCCGGATGGGAGGTGATGAATTTGAACTAAAACGATAA