SecReT6
Protein ID: 53713239
SecReT6 ID908
T6SS typeiii
Gene symbol-
Locus tagBF1949
StrainBacteroides fragilis YCH46
Repliconchromosome [GenBank: NC_006347] [Browse all T6SS(s) in this replicon]
Location [Strand]2291941..2292348 [-]
Producthypothetical protein
NoteHcp
UniProt IDQ64UY2
KEGG IDbfr:BF1949
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 135 a.a.     [Download]
>gi|53713239|ref|YP_099231.1| hypothetical protein BF1949 [Bacteroides fragilis YCH46]
MQTHLYLHKENTDLPHDEYRGKYPLKHFDYGLSRNVGRKGEITSGVCGGEIRIVIDGFADATLLGWLFDT
FRKEDGAIVTLDEHETTFAKLQFSGASVRSYRMNYDSRVKKGVVTIIVIEAKEIVTDNDLFFKNK
 
Nucleotide Sequence: 408 bp     [Download]
>gi|53711291|ref|NC_006347.1|:c2292348-2291941 Bacteroides fragilis YCH46 chromosome, complete genome
ATGCAAACGCACCTGTACCTTCATAAAGAGAACACCGACCTACCCCACGACGAGTACCGGGGGAAGTATC
CGCTGAAACACTTTGATTACGGATTGAGCCGTAATGTGGGGCGTAAAGGTGAAATCACTTCCGGCGTATG
CGGCGGAGAAATACGAATCGTCATTGATGGATTTGCTGACGCTACCCTGCTGGGATGGCTCTTTGACACC
TTCCGTAAAGAAGATGGAGCGATTGTTACACTGGATGAACACGAAACGACCTTTGCCAAACTGCAATTTT
CGGGCGCATCGGTAAGGAGCTATCGTATGAACTACGATTCGCGGGTTAAAAAAGGTGTGGTGACTATCAT
TGTGATAGAAGCCAAAGAGATTGTAACGGACAATGACTTATTTTTTAAAAACAAATAA