SecReT6
Protein ID: 53713242
SecReT6 ID908
T6SS typeiii
Gene symbol-
Locus tagBF1952
StrainBacteroides fragilis YCH46
Repliconchromosome [GenBank: NC_006347] [Browse all T6SS(s) in this replicon]
Location [Strand]2293947..2294351 [-]
Producthypothetical protein
NoteHcp
UniProt IDQ64UX9
KEGG IDbfr:BF1952
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 134 a.a.     [Download]
>gi|53713242|ref|YP_099234.1| hypothetical protein BF1952 [Bacteroides fragilis YCH46]
MGLFSLPKIDSDLTARFILDGKEYEMSQFSISFGQSVDHKGQPQDEVRGGRMLVVLTQALPDNLYRWAMT
SSPKNGEIVFRSKTANSPLRIMFNNAYCVSFQRQVGNASGMISKLLISPDEILMNGISFDNHWG
 
Nucleotide Sequence: 405 bp     [Download]
>gi|53711291|ref|NC_006347.1|:c2294351-2293947 Bacteroides fragilis YCH46 chromosome, complete genome
ATGGGATTATTTAGCTTACCAAAGATAGACAGCGATTTGACTGCACGATTCATCCTTGACGGCAAAGAGT
ATGAGATGAGCCAATTTAGCATAAGTTTCGGACAGTCGGTTGATCATAAAGGTCAACCGCAAGACGAAGT
CCGTGGCGGTAGAATGCTTGTTGTTTTGACGCAGGCGCTACCGGACAATCTTTATCGTTGGGCAATGACT
TCATCTCCTAAAAACGGGGAGATTGTATTTCGTTCTAAAACCGCCAATTCACCTTTGCGGATAATGTTTA
ATAATGCGTATTGTGTGAGTTTTCAGCGTCAGGTTGGTAATGCTTCCGGTATGATTTCAAAACTATTAAT
TTCTCCTGATGAGATTCTGATGAATGGAATTAGCTTTGATAATCACTGGGGTTAA