SecReT6
Protein ID: 53713243
SecReT6 ID908
T6SS typeiii
Gene symbol-
Locus tagBF1953
StrainBacteroides fragilis YCH46
Repliconchromosome [GenBank: NC_006347] [Browse all T6SS(s) in this replicon]
Location [Strand]2294357..2294785 [-]
Producthypothetical protein
NoteHcp
UniProt IDQ64UX8
KEGG IDbfr:BF1953
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 142 a.a.     [Download]
>gi|53713243|ref|YP_099235.1| hypothetical protein BF1953 [Bacteroides fragilis YCH46]
MFGHKSFLRIGALSDSSISGLYKDSYELENCNFSFSQGVDGNGKPQTEVRGGTISLTYGGLPQQDLLRWM
LGSTKYEDGAIVVCDDNNEPLEKIFFEQAACVGLEIDYVQQGKGYIQSKITLQARKIKVGETALENRWTI
NK
 
Nucleotide Sequence: 429 bp     [Download]
>gi|53711291|ref|NC_006347.1|:c2294785-2294357 Bacteroides fragilis YCH46 chromosome, complete genome
ATGTTTGGACATAAAAGTTTTTTGAGGATAGGTGCTTTGAGCGATTCCAGTATTTCGGGGTTGTACAAAG
ACAGTTACGAACTTGAAAATTGCAACTTTAGTTTTTCGCAAGGAGTCGATGGTAATGGTAAACCACAAAC
GGAAGTTCGTGGGGGAACAATAAGTCTTACTTACGGTGGTTTACCTCAGCAAGATTTACTCCGCTGGATG
TTAGGTTCGACCAAGTATGAAGATGGAGCTATCGTTGTGTGTGACGACAATAATGAACCTTTAGAGAAAA
TTTTCTTCGAGCAGGCAGCTTGCGTTGGCTTGGAGATAGATTATGTCCAACAAGGAAAAGGATATATTCA
ATCTAAGATAACATTGCAGGCACGCAAAATCAAAGTGGGTGAAACCGCCCTTGAAAACCGTTGGACAATT
AATAAATAA