SecReT6
Protein ID: 53713246
SecReT6 ID908
T6SS typeiii
Gene symbol-
Locus tagBF1956
StrainBacteroides fragilis YCH46
Repliconchromosome [GenBank: NC_006347] [Browse all T6SS(s) in this replicon]
Location [Strand]2298692..2299141 [-]
Producthypothetical protein
NoteTssB
UniProt IDQ64UX5
KEGG IDbfr:BF1956
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 149 a.a.     [Download]
>gi|53713246|ref|YP_099238.1| hypothetical protein BF1956 [Bacteroides fragilis YCH46]
MAILEYGIGGNEVKVDTSEAIANIPENRSLIVEQLTADEPITPEAVKGLSTIEEVFAHFLPNIDVEFENE
EGQPVKENFRFSSVADFSVKNMTQNSPFLHKLDTEKTFYEGMVTQLRSNKVLQRVLENPESKKAFISALE
ALSNELKTE
 
Nucleotide Sequence: 450 bp     [Download]
>gi|53711291|ref|NC_006347.1|:c2299141-2298692 Bacteroides fragilis YCH46 chromosome, complete genome
ATGGCAATACTTGAATATGGAATTGGTGGTAATGAAGTGAAAGTTGATACTTCCGAAGCCATCGCAAACA
TTCCGGAGAATCGCTCCCTCATAGTTGAACAGTTAACTGCTGACGAACCTATAACTCCTGAAGCGGTCAA
AGGCTTAAGCACTATCGAAGAGGTGTTTGCGCACTTCTTGCCCAACATTGATGTTGAATTTGAAAATGAA
GAAGGGCAACCGGTAAAAGAAAACTTTAGATTTAGCTCAGTGGCGGACTTCAGTGTGAAGAATATGACAC
AGAATAGTCCATTCCTCCATAAGTTGGATACGGAGAAAACATTCTACGAGGGGATGGTGACACAATTGCG
TTCTAATAAAGTTCTACAACGAGTGTTGGAGAATCCGGAATCCAAAAAGGCGTTTATCAGCGCACTGGAG
GCATTGAGTAACGAATTAAAGACCGAATAA