SecReT6
Protein ID: 53713247
SecReT6 ID908
T6SS typeiii
Gene symbol-
Locus tagBF1957
StrainBacteroides fragilis YCH46
Repliconchromosome [GenBank: NC_006347] [Browse all T6SS(s) in this replicon]
Location [Strand]2299231..2299620 [-]
Producthypothetical protein
NoteHcp
UniProt IDQ64UX4
KEGG IDbfr:BF1957
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 129 a.a.     [Download]
>gi|53713247|ref|YP_099239.1| hypothetical protein BF1957 [Bacteroides fragilis YCH46]
MAFRATLSFAGKEFDVLDCTYSLKRDVDSKGRPSSNIYGGQIRLHVESTDDTSILENMTNQFKPHSGSIV
FKKGDEEAKMKELTWENGYITEFTENIDIVGSQPMTITFVVSAQVIKIGGAQFEQNWPK
 
Nucleotide Sequence: 390 bp     [Download]
>gi|53711291|ref|NC_006347.1|:c2299620-2299231 Bacteroides fragilis YCH46 chromosome, complete genome
ATGGCATTTAGAGCAACCTTAAGCTTTGCAGGAAAAGAGTTTGACGTGCTGGATTGCACGTACAGTCTCA
AGCGAGATGTGGATTCCAAAGGACGCCCATCTTCAAACATTTATGGTGGACAAATTCGTCTGCATGTGGA
ATCGACTGATGATACTTCGATTCTGGAGAACATGACCAATCAGTTTAAACCTCATTCCGGCAGCATCGTC
TTCAAAAAAGGAGATGAAGAAGCCAAGATGAAGGAACTTACCTGGGAAAACGGATACATTACCGAATTTA
CCGAAAACATCGACATTGTCGGCTCGCAGCCGATGACTATCACTTTTGTCGTATCGGCTCAGGTAATCAA
GATTGGTGGCGCACAATTTGAACAGAATTGGCCGAAGTAA