SecReT6
Protein ID: 53714123
SecReT6 ID909
T6SS typeiii
Gene symbol-
Locus tagBF2831
StrainBacteroides fragilis YCH46
Repliconchromosome [GenBank: NC_006347] [Browse all T6SS(s) in this replicon]
Location [Strand]3238391..3239770 [-]
Producthypothetical protein
NoteTssC
UniProt IDQ64SE9
KEGG IDbfr:BF2831
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.30E-15, Aligned region: 122..260
DUF877 [PF05943], Evalue: 1.30E-15, Aligned region: 291..437
Phage_sheath_1 [PF04984], Evalue: 0.0035, Aligned region: 350..437
Protein Sequence: 459 a.a.     [Download]
>gi|53714123|ref|YP_100115.1| hypothetical protein BF2831 [Bacteroides fragilis YCH46]
MKQETQQQTASTTTSQKVVSQQAQKSSASAIDKLKEFGGFAFLENIIDGYSNLNPARKARRNIFLTDEQW
ENERKALVNRLSVWLKLLRENDTAEQMRDKAKETAENAENLLNHNLKNALARTRELESAYRTIAFFYKNT
ESDKVKNVTIVNATMEQLQDLDNTIFADHISNELKQNFDRLDLRRNYSLLVVPGYIGSNAILDKWSKMAY
ENKVFLVTDFQDLETPDDVVDIFFNANHTSGDVFKSNTIMTCNWLLGRQREESVGEEENLYIPPSSSLAG
KIYNTLMSQVVAGKKFGGLNEVESVRFDLRKSEISELERMGLVPMVNEYSKVMAFSAKTLFNGDNLGLQT
YSVVRVFDYITKVLIDFLNRRAFENWTTRTEADLRGQVVKFLDSVMGPNKLIERFKVMKIEQDPNQKDRV
LLDIHITPYFPAKSFVIQLAGHKGDNPEDAIWESEYHQE
 
Nucleotide Sequence: 1380 bp     [Download]
>gi|53711291|ref|NC_006347.1|:c3239770-3238391 Bacteroides fragilis YCH46 chromosome, complete genome
ATGAAGCAGGAAACTCAACAACAGACAGCCAGTACGACAACCTCACAGAAAGTCGTATCACAACAGGCGC
AAAAGTCATCTGCATCGGCAATAGACAAACTCAAAGAATTTGGTGGCTTCGCTTTTCTTGAAAATATCAT
AGATGGGTATTCCAATCTTAATCCGGCACGAAAGGCCCGTCGCAACATCTTCCTCACGGATGAACAGTGG
GAAAATGAACGTAAGGCCTTGGTTAATCGCTTAAGCGTATGGCTCAAACTCTTACGTGAGAATGACACTG
CCGAACAAATGCGGGACAAGGCCAAAGAAACCGCAGAAAACGCCGAGAACCTTCTTAATCATAACTTGAA
GAATGCTCTTGCCAGGACACGGGAACTTGAAAGCGCATATCGCACTATTGCGTTCTTTTACAAGAACACG
GAAAGTGATAAGGTGAAGAATGTCACCATTGTCAATGCGACCATGGAGCAGCTTCAGGATTTGGACAATA
CCATTTTCGCTGACCACATTAGCAACGAACTCAAACAGAATTTTGACCGTCTTGACCTGCGTCGCAACTA
CTCCTTGCTTGTCGTTCCTGGGTATATAGGCTCAAATGCCATTTTGGATAAGTGGTCTAAAATGGCATAC
GAGAACAAGGTTTTTCTTGTTACAGACTTCCAAGACCTTGAAACTCCGGACGATGTAGTAGATATATTCT
TCAATGCCAATCATACGAGTGGAGATGTGTTCAAATCGAATACTATTATGACCTGTAACTGGTTGCTTGG
TCGTCAAAGAGAGGAAAGCGTTGGAGAAGAAGAAAATCTTTATATTCCGCCATCTTCTTCACTTGCCGGA
AAAATATACAACACCTTAATGTCTCAGGTAGTAGCCGGAAAGAAATTTGGTGGACTTAATGAAGTAGAAA
GTGTACGCTTCGACCTTCGCAAGAGCGAGATTTCAGAGCTTGAACGTATGGGGCTTGTGCCGATGGTGAA
CGAGTACAGCAAGGTTATGGCTTTCTCCGCCAAGACATTATTTAATGGAGATAATCTTGGCTTGCAGACC
TACTCCGTAGTTCGTGTATTCGACTATATAACGAAGGTACTGATTGACTTCCTGAACCGTCGGGCATTTG
AAAATTGGACTACTCGCACGGAAGCAGATTTGCGTGGTCAGGTTGTGAAATTCCTCGATAGTGTAATGGG
ACCGAACAAACTCATCGAACGCTTCAAGGTTATGAAGATTGAACAAGACCCGAATCAGAAAGACCGTGTG
CTTCTTGACATCCACATCACACCGTATTTCCCGGCAAAAAGCTTCGTGATACAGCTTGCCGGTCATAAAG
GCGATAATCCGGAGGATGCTATTTGGGAAAGCGAATATCATCAAGAATAG