SecReT6
Protein ID: 53714124
SecReT6 ID909
T6SS typeiii
Gene symbol-
Locus tagBF2832
StrainBacteroides fragilis YCH46
Repliconchromosome [GenBank: NC_006347] [Browse all T6SS(s) in this replicon]
Location [Strand]3239783..3240250 [-]
Producthypothetical protein
NoteTssB
UniProt IDQ64SE8
KEGG IDbfr:BF2832
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 155 a.a.     [Download]
>gi|53714124|ref|YP_100116.1| hypothetical protein BF2832 [Bacteroides fragilis YCH46]
MAIYNYGIGGNEVKVDANESIAEIPSNRTLIVQKLTDEAPAAPESVYGLETIEDVFQRFEPTVDLCHVDA
EGNEIKEIMTFTGLGDFGAKKIKEKSDFLSKLDIEKEQGVRITRQLTSNRALQKALENPEVKNAIMDVIE
SSIEEILANQKKVEL
 
Nucleotide Sequence: 468 bp     [Download]
>gi|53711291|ref|NC_006347.1|:c3240250-3239783 Bacteroides fragilis YCH46 chromosome, complete genome
ATGGCAATCTACAATTATGGAATTGGAGGCAACGAAGTAAAAGTCGATGCGAACGAATCCATCGCGGAAA
TCCCCTCCAACCGAACTTTGATAGTTCAAAAACTGACAGATGAAGCTCCTGCGGCTCCGGAAAGCGTGTA
TGGTTTGGAAACCATTGAAGATGTGTTCCAACGTTTTGAACCAACAGTTGACTTATGCCACGTGGATGCG
GAAGGTAATGAAATCAAGGAAATCATGACATTCACCGGACTTGGAGACTTCGGAGCCAAGAAGATTAAAG
AGAAGAGTGATTTCTTGAGTAAACTTGACATTGAGAAAGAGCAGGGTGTCAGAATAACTCGCCAGCTTAC
TTCCAACCGCGCTTTACAGAAAGCACTTGAAAATCCGGAAGTCAAAAATGCCATTATGGACGTGATTGAA
TCATCAATCGAGGAGATTCTGGCAAATCAAAAGAAAGTAGAACTTTAA