SecReT6
Protein ID: 53714125
SecReT6 ID909
T6SS typeiii
Gene symbol-
Locus tagBF2833
StrainBacteroides fragilis YCH46
Repliconchromosome [GenBank: NC_006347] [Browse all T6SS(s) in this replicon]
Location [Strand]3240418..3240840 [+]
Producthypothetical protein
NoteTssE
UniProt IDQ64SE7
KEGG IDbfr:BF2833
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.00E-14, Aligned region: 19..123
DisA-linker [PF10635], Evalue: 0.0022, Aligned region: 11..39
DisA-linker [PF10635], Evalue: 0.0022, Aligned region: 55..65
DisA-linker [PF10635], Evalue: 0.0022, Aligned region: 72..100
Protein Sequence: 140 a.a.     [Download]
>gi|53714125|ref|YP_100117.1| hypothetical protein BF2833 [Bacteroides fragilis YCH46]
MTYLKMPLQLQSAVAKKLQRCSYQESIAQHIMLLILSHHGEVIGREDFGSMIWDLEFNQLVKISDWEEGV
KNSLIKTIEKYEKRLRNVDVNVTLLEIEEENIDKVSHIRRKAQITVTGIMDRTNEKFSFNTSLYISPLSQ
 
Nucleotide Sequence: 423 bp     [Download]
>gi|53711291|ref|NC_006347.1|:3240418-3240840 Bacteroides fragilis YCH46 chromosome, complete genome
ATGACTTACCTGAAAATGCCATTACAATTGCAATCGGCTGTTGCCAAGAAATTGCAAAGGTGTTCCTATC
AGGAATCGATAGCCCAACACATCATGCTACTGATTCTTTCTCACCATGGGGAAGTTATCGGCCGAGAAGA
CTTTGGTTCCATGATATGGGACCTTGAGTTCAACCAACTTGTGAAAATCAGCGATTGGGAGGAAGGAGTA
AAAAACTCCTTAATAAAAACGATAGAGAAATATGAAAAGAGACTACGGAATGTAGATGTGAACGTCACCC
TTTTGGAAATAGAAGAAGAAAATATAGATAAAGTATCTCATATCCGAAGAAAGGCACAAATAACGGTGAC
CGGAATAATGGATAGAACCAACGAGAAATTCAGTTTTAACACCTCATTATATATAAGCCCTTTATCACAA
TAA