SecReT6
Protein ID: 53714126
SecReT6 ID909
T6SS typeiii
Gene symbol-
Locus tagBF2834
StrainBacteroides fragilis YCH46
Repliconchromosome [GenBank: NC_006347] [Browse all T6SS(s) in this replicon]
Location [Strand]3240848..3242623 [+]
Producthypothetical protein
NoteTssF
UniProt IDQ64SE6
KEGG IDbfr:BF2834
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 0.002, Aligned region: 23..88
Protein Sequence: 591 a.a.     [Download]
>gi|53714126|ref|YP_100118.1| hypothetical protein BF2834 [Bacteroides fragilis YCH46]
MSDKKQIAIKERILKQAMEFWGVSDIRDMDPVIDLLLEVFAHESNKLHQEIDQSDSRILHRLSRILIGNK
WSLPKPAHALMTITPNHGECCELDAEDHFYAEKNIFGKGDIQVFITPLFSYKLVDAKVKAIAYNDSIRHS
TDSFSTPTRFLGPKNRIADYCIWVGLDVSKEVLQKMDSVMFCIKPSDMGLLPFMNMAFFYDCTGNRLNAK
TGLHVEDPYSNAHYFDEIRDFYSDLYFNVGIKDASKEKHTYREMFPGYVADCEVPDDSENLFWVKIVFPE
IFTKESLENLEVYLNTFPVVNRQIVYKQHNFRSTGRIIPLKCPGRTQFLNIRSFQDNKGREYVNRLNQYE
ENPTGIFSLYFGDLERFDSDSARSLISKVLQLMKEDGSAFASMNPDALSTQLKELFNKINDIEKGLEATL
KGDNKIKAFVLSVPQKDATNAEIKYWVTSGSLANGFNERTLIQQFNIEKYDASGIMLRTCMQGGTTHDSE
QELINSLRYGLLSRERIISKEDIKSYLFHKLGKHVESVEVGNGVAISPDSKKGLIRVTEVKIKLGQFDKD
EIPNLEELAHYLEKDLTERSVCNSNYKIKFV
 
Nucleotide Sequence: 1776 bp     [Download]
>gi|53711291|ref|NC_006347.1|:3240848-3242623 Bacteroides fragilis YCH46 chromosome, complete genome
ATGTCAGACAAGAAACAAATCGCAATAAAGGAACGAATATTAAAGCAGGCTATGGAGTTTTGGGGTGTAT
CCGATATACGCGATATGGACCCCGTGATAGATTTGCTGCTTGAAGTTTTTGCCCATGAGTCCAACAAGCT
GCATCAAGAAATAGATCAGTCCGATTCACGGATACTTCACCGCCTGTCCAGAATACTCATAGGAAACAAA
TGGTCGCTGCCAAAGCCGGCCCATGCGCTTATGACTATTACCCCCAATCATGGGGAATGTTGCGAACTTG
ATGCCGAAGATCATTTTTATGCAGAGAAAAACATATTTGGCAAAGGGGATATTCAAGTCTTTATAACCCC
TTTGTTTTCCTATAAACTGGTTGATGCAAAAGTCAAAGCAATCGCATACAACGATAGTATAAGGCATTCA
ACCGATAGCTTTAGCACTCCAACACGCTTCCTTGGCCCTAAAAACCGGATAGCGGATTATTGCATCTGGG
TCGGGCTGGATGTGTCTAAAGAAGTCCTGCAAAAAATGGACTCTGTAATGTTTTGTATCAAGCCTTCCGA
TATGGGGTTGCTTCCGTTTATGAATATGGCTTTCTTCTATGACTGCACAGGAAACCGATTGAATGCAAAA
ACAGGCCTTCATGTTGAAGATCCATATAGTAATGCGCACTACTTTGATGAAATCCGCGATTTTTATAGTG
ACCTATATTTTAATGTGGGTATAAAAGATGCTTCCAAAGAGAAACATACCTACCGAGAAATGTTTCCCGG
TTATGTGGCCGACTGCGAGGTCCCGGATGACTCTGAGAATCTCTTTTGGGTCAAGATAGTCTTTCCTGAA
ATATTCACGAAAGAAAGTCTTGAAAATCTGGAAGTATATTTGAACACATTTCCGGTTGTAAACAGACAAA
TCGTTTACAAACAGCATAATTTCCGTTCCACCGGACGAATTATACCCCTGAAATGTCCGGGCCGTACACA
ATTCTTGAACATACGCTCGTTTCAAGACAACAAAGGCCGGGAATATGTAAACCGACTGAACCAGTATGAG
GAAAATCCGACAGGTATATTCAGCCTGTATTTTGGCGACCTTGAACGATTTGATTCGGACAGTGCCCGCT
CATTAATTTCAAAAGTGTTACAATTAATGAAAGAAGACGGGAGTGCTTTTGCTTCAATGAATCCGGATGC
ACTTTCGACGCAGCTCAAAGAGTTGTTCAACAAGATAAATGATATAGAGAAAGGATTGGAGGCCACGCTA
AAAGGAGATAACAAAATAAAGGCCTTTGTTTTAAGTGTCCCACAAAAGGATGCGACCAATGCCGAGATAA
AATATTGGGTGACTTCCGGATCTCTGGCGAACGGTTTCAATGAACGCACACTGATACAGCAATTCAACAT
AGAAAAATATGACGCTTCAGGCATCATGTTGCGCACTTGTATGCAAGGAGGAACAACGCATGATAGCGAA
CAGGAACTTATTAATAGTTTAAGGTATGGTCTGTTGTCCCGGGAACGGATTATATCTAAAGAAGACATCA
AAAGCTACTTGTTTCACAAGCTGGGAAAACATGTTGAATCAGTCGAAGTCGGTAATGGCGTAGCTATATC
TCCTGACAGCAAAAAAGGATTAATCAGAGTGACAGAGGTCAAGATAAAACTTGGACAATTTGATAAAGAT
GAAATTCCCAATCTGGAAGAATTGGCCCATTATCTTGAAAAAGATTTGACTGAACGCTCTGTATGTAATT
CAAACTATAAAATCAAATTCGTATGA