SecReT6
Protein ID: 53714128
SecReT6 ID909
T6SS typeiii
Gene symbol-
Locus tagBF2836
StrainBacteroides fragilis YCH46
Repliconchromosome [GenBank: NC_006347] [Browse all T6SS(s) in this replicon]
Location [Strand]3245043..3245978 [+]
Producthypothetical protein
NoteTssG
UniProt IDQ64SE4
KEGG IDbfr:BF2836
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 311 a.a.     [Download]
>gi|53714128|ref|YP_100120.1| hypothetical protein BF2836 [Bacteroides fragilis YCH46]
MGTMLAQKKPLESIQRSQAINFVAEIFYDELQFILDRRLLDHTMVNCHGMNSRVKSRDVLSVSVQHIAAT
NADKEYILLNLARNSIYHQLPELLFHPLVLSTPGMSNKEIVEAIRANEKQDKELIQFFAPFDTEFFKEKV
RINNRHLNFFSDPDSKKNFIKMIEVMENVELSITSHQKYKLFLFLCNAERYKENLPAIEQLLLIVLGLKV
KLRLEVHEIDETVYLSVGSGCVGQTLGLNGLMISETDDLTATIILDTPTDDYEEVKTHLSNVRRILEFFI
LSTRNIEVDYLVRGETDFILGENRLGYNMNL
 
Nucleotide Sequence: 936 bp     [Download]
>gi|53711291|ref|NC_006347.1|:3245043-3245978 Bacteroides fragilis YCH46 chromosome, complete genome
ATGGGAACAATGTTAGCGCAAAAGAAACCCTTGGAAAGCATCCAACGAAGTCAGGCAATAAATTTTGTCG
CAGAAATCTTTTATGATGAACTTCAATTTATTCTTGACCGGCGGCTGTTGGACCATACTATGGTTAATTG
CCATGGTATGAACAGTCGTGTGAAATCCAGAGATGTATTAAGTGTTTCGGTACAGCATATCGCGGCGACA
AATGCCGACAAAGAATATATATTGCTGAATCTGGCAAGAAACAGCATCTATCATCAATTGCCGGAATTAC
TATTTCATCCATTGGTGCTTAGCACACCGGGCATGAGCAACAAGGAGATAGTTGAAGCCATCCGAGCCAA
TGAAAAACAGGATAAAGAGCTTATACAATTCTTTGCACCCTTTGATACAGAGTTTTTCAAAGAAAAGGTC
CGTATCAATAACCGCCATCTGAATTTCTTTTCAGACCCGGACTCCAAGAAGAACTTCATCAAGATGATTG
AAGTAATGGAAAATGTCGAACTATCCATTACTTCCCATCAGAAATATAAGCTGTTCCTATTCCTCTGCAA
TGCAGAACGGTATAAAGAGAACCTGCCTGCTATCGAGCAACTGCTTCTTATCGTTTTGGGATTGAAGGTG
AAACTGCGACTGGAAGTCCATGAGATTGATGAAACGGTTTACCTTTCCGTCGGTTCCGGATGTGTCGGAC
AGACATTAGGCCTTAATGGTCTAATGATAAGCGAAACCGATGATTTGACGGCGACAATCATCCTTGATAC
TCCGACAGATGACTATGAGGAGGTAAAAACGCATCTATCCAATGTCCGCCGGATACTTGAATTTTTCATC
CTTTCAACAAGAAATATCGAAGTTGATTATCTGGTACGTGGAGAAACGGATTTTATACTCGGAGAAAACC
GATTAGGATATAATATGAACTTATGA