SecReT6
Protein ID: 53714129
SecReT6 ID909
T6SS typeiii
Gene symbol-
Locus tagBF2837
StrainBacteroides fragilis YCH46
Repliconchromosome [GenBank: NC_006347] [Browse all T6SS(s) in this replicon]
Location [Strand]3245992..3246870 [+]
Producthypothetical protein
NoteTssN
UniProt IDQ64SE3
KEGG IDbfr:BF2837
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 292 a.a.     [Download]
>gi|53714129|ref|YP_100121.1| hypothetical protein BF2837 [Bacteroides fragilis YCH46]
MKILLYFFARYLLAPLFVAVMIFVLTGIKTIKSKLSLKKLIIFILLASIAVALPSLFGFLKNEYVWGGLT
FTILSYILLGALFCKLSTSDLFGAIGIGSSRTAVILTLTTICALGGWCYYLLFELISKLPYSLWNTTNIL
WFAIPYLIMYSRTLFLDIPHPIYTPWELSYGTFDRKYWDNIDNFGFRTVKVKIKRNIKDPTYASLVVRLP
NEISLGNWFNWVIEDQNRRFPQNKIETEKEDMQIGWMFYTSKWFNFPLFIRILDPTLTSEGNKIKNNQTI
YIRRVQVETKTS
 
Nucleotide Sequence: 879 bp     [Download]
>gi|53711291|ref|NC_006347.1|:3245992-3246870 Bacteroides fragilis YCH46 chromosome, complete genome
ATGAAGATATTGCTATATTTCTTTGCACGTTATTTATTGGCTCCATTATTTGTAGCCGTGATGATATTTG
TCTTGACCGGAATAAAAACGATCAAGAGCAAACTTAGCCTGAAGAAATTAATCATATTCATTCTTCTGGC
TTCCATTGCCGTTGCTTTACCCAGCCTGTTCGGTTTCCTAAAAAACGAATACGTCTGGGGAGGCTTGACA
TTCACGATATTGTCCTATATCCTCCTTGGAGCATTGTTCTGCAAACTGTCAACCTCCGATTTGTTCGGAG
CAATCGGTATTGGCAGTTCCCGAACAGCGGTCATTCTCACTCTAACCACAATATGCGCTTTAGGCGGATG
GTGCTACTATCTACTGTTTGAACTGATAAGCAAGCTACCTTATTCGCTATGGAACACAACAAATATCCTG
TGGTTTGCAATCCCATATCTGATTATGTACAGCAGAACCCTGTTCCTGGACATCCCGCACCCGATATATA
CCCCATGGGAATTGAGCTATGGTACCTTTGACCGGAAATATTGGGACAACATAGACAACTTCGGCTTCCG
AACGGTCAAAGTCAAAATCAAACGGAATATAAAAGACCCGACATACGCTTCGTTGGTTGTCCGCCTGCCC
AATGAAATATCTCTTGGGAATTGGTTCAATTGGGTTATCGAAGACCAAAACAGGCGTTTCCCCCAAAACA
AGATTGAAACAGAGAAGGAAGATATGCAAATCGGATGGATGTTCTATACCTCAAAATGGTTTAACTTCCC
GTTGTTCATAAGAATACTTGACCCCACTCTGACGAGTGAGGGCAATAAGATTAAGAATAATCAAACGATA
TATATCCGACGTGTACAAGTAGAAACAAAAACATCATAA