SecReT6
Protein ID: 53714130
SecReT6 ID909
T6SS typeiii
Gene symbol-
Locus tagBF2838
StrainBacteroides fragilis YCH46
Repliconchromosome [GenBank: NC_006347] [Browse all T6SS(s) in this replicon]
Location [Strand]3246874..3248022 [+]
Producthypothetical protein
NoteTssK
UniProt IDQ64SE2
KEGG IDbfr:BF2838
PDB IDNA
Domain hit(s) vs Pfam DALR_1 [PF05746], Evalue: 0.0027, Aligned region: 225..280
Talin_middle [PF09141], Evalue: 0.0072, Aligned region: 197..251
Talin_middle [PF09141], Evalue: 0.0072, Aligned region: 268..293
Talin_middle [PF09141], Evalue: 0.0072, Aligned region: 312..343
Protein Sequence: 382 a.a.     [Download]
>gi|53714130|ref|YP_100122.1| hypothetical protein BF2838 [Bacteroides fragilis YCH46]
MKTLTYLPVNWVNGLKLTSQHFFANQYCQTEALNREAGRSLTSYNYGLGEVLEGIGDNLEIEISGDTMST
LCVRLKSCNAITKGGLPIVYYDGLYGDEKPCATISESGLQAEDSEYMVLISVDPYHLIPVGEPDPEEVPL
HHPYVLPSIKLHIVPRNQVNKSFYSQNFLLVAEVCRQGNTYKINHQYIPPVQHSACHDGIKTFISQLART
LQSIKEDVKLIYSRNVADKRRDTLANNTFELCKAFSAFYNSRIFFIEQIALEQPPIYLVQAVNELANGLN
SALQSLSETEREQLLQYFYEWTNVTPSEFITKIESLTKLMYDHTNINQSLQTAGAFVTLLSNMFHKMSEL
EYIGMVRENIIVGDESHETIEAQKKRSWSFIG
 
Nucleotide Sequence: 1149 bp     [Download]
>gi|53711291|ref|NC_006347.1|:3246874-3248022 Bacteroides fragilis YCH46 chromosome, complete genome
ATGAAAACACTAACATATTTGCCTGTAAACTGGGTCAATGGTCTGAAGCTGACCAGCCAGCATTTCTTTG
CAAACCAATATTGCCAAACGGAAGCTCTCAACCGCGAAGCAGGAAGGAGTCTGACCAGTTATAACTATGG
TCTTGGAGAGGTCCTTGAAGGGATAGGTGACAATCTTGAAATAGAGATTTCAGGTGATACCATGTCCACT
CTCTGTGTCCGCCTGAAAAGCTGCAACGCTATCACCAAAGGCGGTCTGCCCATCGTTTATTACGACGGTT
TATACGGGGATGAGAAACCCTGTGCAACCATTTCAGAATCCGGTCTGCAAGCCGAGGACAGCGAGTATAT
GGTACTAATATCCGTAGATCCGTATCACTTGATACCTGTCGGTGAACCGGACCCGGAAGAGGTGCCTTTG
CATCACCCGTATGTCTTGCCGAGCATAAAACTCCATATCGTTCCCAGAAACCAAGTCAACAAATCTTTCT
ACAGCCAGAATTTTTTGCTGGTGGCAGAGGTATGCAGACAAGGGAATACCTATAAAATCAATCATCAATA
TATTCCACCGGTACAACATTCCGCTTGCCACGATGGGATTAAAACATTCATTTCCCAATTGGCACGTACC
CTACAGTCGATAAAAGAAGACGTGAAACTCATTTACAGCAGGAATGTTGCTGACAAGCGTAGAGATACGC
TTGCCAATAATACATTTGAGCTGTGTAAGGCTTTCTCGGCCTTTTACAACTCAAGAATCTTCTTTATCGA
ACAAATCGCCTTAGAGCAACCGCCGATATATCTTGTGCAGGCCGTGAATGAGCTTGCAAACGGTCTGAAC
TCCGCTCTTCAAAGTCTTTCTGAAACGGAAAGAGAACAATTGCTCCAATACTTCTATGAGTGGACCAATG
TCACACCCTCTGAATTTATCACGAAGATAGAGAGCCTAACCAAGCTTATGTATGACCATACCAATATAAA
CCAATCATTGCAGACGGCAGGGGCATTTGTGACACTGCTCAGCAATATGTTCCACAAAATGAGTGAACTG
GAATACATCGGAATGGTTCGTGAGAATATTATAGTAGGAGACGAAAGTCACGAAACAATAGAGGCTCAAA
AGAAACGATCATGGTCGTTTATAGGTTGA