SecReT6
Protein ID: 53714133
SecReT6 ID909
T6SS typeiii
Gene symbol-
Locus tagBF2841
StrainBacteroides fragilis YCH46
Repliconchromosome [GenBank: NC_006347] [Browse all T6SS(s) in this replicon]
Location [Strand]3248994..3249935 [+]
Producthypothetical protein
NoteTssP
UniProt IDQ64SD9
KEGG IDbfr:BF2841
PDB IDNA
Domain hit(s) vs Pfam PKD [PF00801], Evalue: 3.90E-09, Aligned region: 71..100
PKD [PF00801], Evalue: 3.90E-09, Aligned region: 136..184
Y_Y_Y [PF07495], Evalue: 0.0057, Aligned region: 83..111
Y_Y_Y [PF07495], Evalue: 0.0057, Aligned region: 162..185
Protein Sequence: 313 a.a.     [Download]
>gi|53714133|ref|YP_100125.1| hypothetical protein BF2841 [Bacteroides fragilis YCH46]
MDNKKTITIIILGLVAMAGILLFLFLPSKSHLANIDFYVYDTNDNFHYEVNERLELLVNDTAAIKGKRLI
WEMGNGDTLMRNTDVSYTYRKAGKYLITLKIDGKHSVNKYIKVISGLEHEAIDSIPRINGVSEGYQGEEL
VFSAEGYGMDTWLWEFGESGTVDAYEQQVVYSYDIPGEYTISLQTNTTKYPVKHRITILPRFEKAEELVT
VDSLVLVQNDIKKHLQAIADAKVSQKSVYYEHTNYIRNKYFCIDADQVVVVINDEKYNDFNGYCQGLHFL
ESNRKKRVSIDDVKIDDLNCVKSIHVTQSYIEK
 
Nucleotide Sequence: 942 bp     [Download]
>gi|53711291|ref|NC_006347.1|:3248994-3249935 Bacteroides fragilis YCH46 chromosome, complete genome
ATGGATAATAAGAAAACTATAACAATCATCATATTGGGACTGGTTGCCATGGCAGGTATCCTTTTGTTTT
TGTTCCTGCCTTCGAAGTCGCACCTTGCCAATATTGACTTTTATGTGTATGACACCAATGATAATTTTCA
TTATGAGGTCAATGAGCGGTTGGAGCTATTAGTCAACGATACGGCAGCGATTAAAGGCAAGCGGCTCATT
TGGGAAATGGGAAACGGTGATACACTGATGAGAAATACGGATGTGTCATACACTTACCGTAAGGCCGGCA
AATATCTTATTACTTTGAAAATAGACGGAAAACACTCCGTAAACAAGTATATCAAAGTTATCTCAGGGCT
GGAGCATGAGGCCATTGATTCCATACCCCGTATAAATGGAGTGTCAGAGGGTTATCAAGGTGAAGAGCTG
GTCTTTTCGGCAGAAGGCTATGGTATGGACACATGGCTATGGGAATTTGGAGAAAGCGGTACTGTGGACG
CATACGAGCAGCAAGTCGTGTATTCGTATGATATTCCGGGAGAATACACCATCTCATTACAAACCAATAC
GACGAAATATCCGGTGAAGCACCGTATAACCATTCTCCCACGCTTTGAAAAAGCAGAGGAACTGGTCACG
GTGGATTCGTTGGTACTGGTACAGAATGATATAAAAAAACACCTGCAAGCCATAGCTGACGCCAAAGTCT
CACAAAAGTCGGTCTATTACGAACATACGAATTATATCCGTAACAAATATTTTTGCATTGATGCAGACCA
GGTAGTGGTCGTCATCAATGATGAAAAATACAATGACTTCAACGGCTATTGCCAAGGACTGCATTTTCTT
GAAAGCAACAGGAAAAAGCGTGTGAGTATTGATGATGTTAAAATTGACGATTTGAATTGCGTCAAGTCCA
TCCATGTGACACAAAGTTATATTGAAAAATGA