SecReT6
Protein ID: 53714136
SecReT6 ID909
T6SS typeiii
Gene symbol-
Locus tagBF2844
StrainBacteroides fragilis YCH46
Repliconchromosome [GenBank: NC_006347] [Browse all T6SS(s) in this replicon]
Location [Strand]3253604..3253999 [+]
Producthypothetical protein
NoteHcp
UniProt IDQ64SD6
KEGG IDbfr:BF2844
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 131 a.a.     [Download]
>gi|53714136|ref|YP_100128.1| hypothetical protein BF2844 [Bacteroides fragilis YCH46]
MAFRASLELNNKEFDVLYSNYEFSRNTDPKGMPSSSVLGGRVKATIESTEDTSVIEAMLNSPFKPVEGKI
IYKKTEEDAKMKEIQFKNAYIVHYSETLDANNDVPMTITITFSAEEIIVGSAALDNRWPKK
 
Nucleotide Sequence: 396 bp     [Download]
>gi|53711291|ref|NC_006347.1|:3253604-3253999 Bacteroides fragilis YCH46 chromosome, complete genome
ATGGCATTTAGAGCATCATTGGAACTTAACAACAAGGAATTTGACGTCCTTTATTCAAACTATGAGTTTA
GTCGTAACACAGACCCTAAAGGTATGCCCTCTTCAAGCGTATTGGGTGGTAGAGTAAAAGCAACCATCGA
ATCAACAGAAGACACTTCTGTCATCGAAGCGATGTTGAACAGTCCTTTCAAACCTGTAGAAGGAAAGATT
ATCTACAAAAAAACGGAGGAAGATGCCAAGATGAAGGAGATTCAGTTCAAGAACGCATACATCGTTCACT
ACTCGGAAACTCTGGACGCGAACAACGATGTGCCTATGACAATCACCATTACGTTCTCCGCTGAAGAAAT
CATCGTCGGCAGCGCAGCTCTTGACAACCGTTGGCCGAAGAAATAA