SecReT6
Protein ID: 53715977
SecReT6 ID71
T6SS typei3
Gene symbol-
Locus tagBMAA1914
StrainBurkholderia mallei ATCC 23344
Repliconchromosome II [GenBank: NC_006349] [Browse all T6SS(s) in this replicon]
Location [Strand]2098163..2099443 [+]
Producthypothetical protein
NoteTssL
UniProt IDQ62A34
KEGG IDbma:BMAA1914
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.70E-68, Aligned region: 51..261
OmpA [PF00691], Evalue: 3.50E-17, Aligned region: 320..418
Protein Sequence: 426 a.a.     [Download]
>gi|53715977|ref|YP_106445.1| unnamed protein product [Burkholderia mallei ATCC 23344]
MTSETVHHPDISAPAPTFDSVAATLARREPAPAPAGEPPAARLAAIRLARNPLLEAARVLLRALADMPER
LDRDDIPQLRLLLEQEVRLFQRLCEQANIRRDHMLGARYCLCTALDEAAMQTSWAQSASGNLGTWISEGL
ATSFHEDRQGGDKVYLLIGRLMNSPHEHIDLLEVIYRILSLGFEGRYRYEADGQRKHETVRQRLYNEIAS
QRGPVSVALSPHWQPGPRNRSAPFRDFPAWVTAAVLSLIALGLFGCFKYALSTRSADVQQRIAAIARMAP
PAAPAELRLATLLAGEIAAGTLSVEENARRSSVTFRGDAMFAPGAAGVNPAMGPLIRKIAAEIARVPGKV
TVRGYTDNQPIKSRQFASNEALSEERATQVMQMLQSAGVPASRLEALGKGGAEPIGDNRTPQGRALNRRV
EITVAR
 
Nucleotide Sequence: 1281 bp     [Download]
>gi|77358719|ref|NC_006349.2|:2098163-2099443 Burkholderia mallei ATCC 23344 chromosome 2, complete sequence
GTGACCTCAGAAACCGTGCATCATCCGGACATATCGGCTCCGGCCCCGACCTTCGATTCCGTCGCGGCGA
CGCTCGCGCGGCGCGAGCCGGCGCCTGCGCCGGCCGGCGAGCCGCCCGCCGCGCGCCTCGCCGCGATCAG
GCTCGCCCGCAACCCGCTGCTCGAAGCCGCGCGCGTGCTGCTGCGGGCGCTCGCCGACATGCCCGAGCGG
CTCGATCGCGACGACATTCCGCAATTGCGACTGCTGCTGGAACAGGAGGTGCGCCTGTTCCAGCGGCTCT
GCGAACAGGCGAACATCCGGCGCGACCACATGCTCGGCGCGCGCTACTGCCTGTGCACCGCGCTCGACGA
GGCGGCGATGCAGACGTCGTGGGCACAATCGGCGAGCGGCAATCTCGGCACGTGGATCAGCGAGGGGCTC
GCGACGTCGTTCCACGAGGATCGCCAGGGCGGAGACAAGGTCTATCTGCTGATCGGCCGGCTGATGAATT
CGCCGCACGAGCACATCGACCTGCTCGAAGTCATCTATCGAATCTTGAGCCTCGGCTTCGAGGGCCGCTA
CCGTTACGAAGCCGACGGCCAGCGCAAGCACGAGACCGTGCGCCAGCGGCTCTACAACGAGATCGCATCG
CAGCGCGGGCCGGTGTCGGTCGCGCTGTCGCCGCACTGGCAGCCCGGCCCCCGCAACAGGAGCGCGCCGT
TTCGCGATTTCCCCGCGTGGGTCACGGCCGCCGTGCTGTCGCTGATCGCGCTCGGGCTGTTCGGCTGCTT
CAAGTACGCGCTGTCGACGCGCAGCGCCGACGTGCAGCAGCGGATCGCCGCGATCGCGCGGATGGCGCCG
CCCGCCGCGCCGGCCGAGCTGCGCCTCGCGACGCTGCTCGCCGGCGAGATCGCGGCAGGCACGCTCAGCG
TCGAGGAAAACGCGCGCCGCAGCTCGGTGACGTTCCGCGGCGACGCGATGTTCGCGCCGGGCGCGGCCGG
CGTGAACCCGGCGATGGGGCCGCTCATCCGGAAAATCGCGGCCGAGATCGCGAGGGTGCCGGGCAAGGTG
ACGGTGCGCGGCTACACCGACAATCAGCCGATCAAAAGCCGCCAGTTCGCGTCGAACGAGGCGCTATCCG
AAGAGCGCGCGACGCAGGTCATGCAGATGCTCCAGAGCGCGGGCGTGCCCGCGAGCCGCCTCGAGGCGCT
CGGCAAGGGCGGCGCCGAGCCGATCGGCGACAACCGGACCCCGCAGGGCCGCGCGCTGAACCGCCGCGTC
GAAATCACGGTCGCGCGCTGA