SecReT6
Protein ID: 53715985
SecReT6 ID71
T6SS typei3
Gene symbol-
Locus tagBMAA1909
StrainBurkholderia mallei ATCC 23344
Repliconchromosome II [GenBank: NC_006349] [Browse all T6SS(s) in this replicon]
Location [Strand]2093394..2093975 [+]
Producthypothetical protein
NoteTssB
UniProt IDQ62A35
KEGG IDbma:BMAA1909
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.80E-59, Aligned region: 11..164
Protein Sequence: 193 a.a.     [Download]
>gi|53715985|ref|YP_106444.1| unnamed protein product [Burkholderia mallei ATCC 23344]
MSASSSSQKFIARNRAPRVQIEYDVEVYGSEKKVELPFVMGVLADLSGKPVAPLPAVADRRFLDIDIDNF
DERMKAIKPRVAFAVDNTLSGDGQLMVDMTFESIEDFSPAAIARMVGPLRQLLEARTQLANLQTYMDDKS
GAETLVNQLLQDPALLRSLAAAPKPQLAGGPDAGNARGAKDAPDTANHDSDAA
 
Nucleotide Sequence: 582 bp     [Download]
>gi|77358719|ref|NC_006349.2|:2093394-2093975 Burkholderia mallei ATCC 23344 chromosome 2, complete sequence
ATGTCCGCATCCAGCAGCTCTCAAAAATTCATCGCGCGCAACCGCGCGCCCCGCGTGCAGATCGAATACG
ACGTCGAAGTCTACGGCTCGGAAAAGAAGGTCGAACTGCCGTTCGTGATGGGCGTGCTCGCCGACCTGTC
GGGCAAGCCGGTCGCGCCGCTGCCCGCCGTCGCCGACCGGCGCTTCCTCGACATCGACATCGACAACTTC
GACGAGCGGATGAAGGCGATCAAGCCGCGCGTGGCGTTCGCGGTGGACAACACGCTGTCGGGCGACGGGC
AGCTGATGGTCGACATGACGTTCGAAAGCATCGAGGACTTCTCGCCCGCCGCGATCGCGCGAATGGTCGG
CCCGTTACGGCAATTGCTCGAGGCGCGCACGCAGCTCGCGAACCTGCAGACCTACATGGACGACAAATCG
GGCGCCGAGACGCTCGTCAACCAGTTGCTGCAGGACCCGGCGCTGCTGCGCTCGCTCGCGGCCGCGCCGA
AGCCGCAGCTCGCTGGCGGGCCGGACGCGGGCAATGCGCGCGGCGCGAAGGACGCGCCCGACACGGCGAA
CCACGACAGCGATGCGGCCTGA