SecReT6
Protein ID: 53715997
SecReT6 ID71
T6SS typei3
Gene symbol-
Locus tagBMAA1901
StrainBurkholderia mallei ATCC 23344
Repliconchromosome II [GenBank: NC_006349] [Browse all T6SS(s) in this replicon]
Location [Strand]2081150..2083477 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDQ62A39
KEGG IDbma:BMAA1901
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.10E-83, Aligned region: 36..361
Phage_GPD [PF05954], Evalue: 1.10E-83, Aligned region: 596..642
Phage_base_V [PF04717], Evalue: 1.50E-21, Aligned region: 299..316
Phage_base_V [PF04717], Evalue: 1.50E-21, Aligned region: 400..492
Protein Sequence: 775 a.a.     [Download]
>gi|53715997|ref|YP_106440.1| unnamed protein product [Burkholderia mallei ATCC 23344]
MPNFSAARTVTVSGPAVPTTPVGEPALELSAIRGDETLSEIYSYTLDCLTPPDPLLAHERAANLDLKAMI
GKALTVTVQLEGMGSFVPGMPGMAGAANIGAGAREISGIVTGARFEGQLNRQCRYRLTMRPWIYLADLRS
DYRIFQNRSVDEIVDEVLNAYSYSYDKRLSGRYPKLGYQVQYGETDFAFIQRLMQEHGIYWFFEHTNQVH
RMVLVDHLGAHKPVESAAYRTLRYYPPGHKIDAEYIDRFSTEEHIRPGRWATGDFDFEKPNADLGVENAL
PRDTAHNGLERYEWPGDYTAREHGEHLARVRMEQTRARGERASGGGNVRDIVCGTTFALAGHPHASANRE
YLVIGATFEATETVGASGPGAYRIDTSFVAQPATTAFRPPRTVRKPRTRGPQTAIVTGPRGQDIWTDQYG
RVKLKFHWDRSLVDDQNSSCWVRVSYAWSGNNYGGVNIPRVGSEVVVDFEHGDPDRPLVTGQVYNALHMP
PWPLPENATQSGFMTRSPAGGGENANMLRFEDKAGEEQVKLHAERNYDVSVERDATTAVGRKHLTLVGVD
LMPVMSTRSPLERLIDLLRTGGAASPAASGQPAAASRQPSGQQQQHQQQHQQHQRQHQPYQQLKQQRQMQ
RAGGWQALAANVAKTLQEIVAVLTDPFVTASVSTVQGASTSVVFGDAKGVHVGDTVKITSGDAHSEVNGT
ASSKDVNSVSLKGTSTSLTGVSTSETGTNIVTTGLTVSTTGASVSTTGFSATETLVQVAKKTQECEFIKG
IKISM
 
Nucleotide Sequence: 2328 bp     [Download]
>gi|77358719|ref|NC_006349.2|:c2083477-2081150 Burkholderia mallei ATCC 23344 chromosome 2, complete sequence
ATGCCGAATTTTTCCGCCGCCCGCACCGTGACGGTGAGCGGCCCTGCCGTGCCGACGACGCCCGTCGGCG
AGCCCGCGCTCGAACTGAGCGCGATCCGGGGCGACGAAACGCTATCGGAAATCTATTCGTACACGCTTGA
TTGCCTGACGCCGCCGGACCCGTTGCTCGCGCACGAGCGGGCCGCGAATCTCGATCTGAAGGCGATGATC
GGCAAGGCGCTGACCGTAACCGTGCAGCTCGAAGGCATGGGCTCGTTCGTGCCCGGCATGCCGGGCATGG
CGGGCGCGGCCAATATCGGCGCGGGCGCGCGCGAGATCAGCGGCATCGTGACCGGCGCGCGCTTCGAGGG
CCAACTGAACCGGCAGTGCCGCTACCGGCTGACGATGCGGCCGTGGATCTACCTGGCCGACCTGCGCTCG
GACTACCGGATTTTCCAGAACCGGAGCGTCGACGAGATCGTCGACGAAGTGCTGAACGCGTATTCGTACT
CGTACGACAAGCGCTTGAGCGGCCGGTATCCGAAGCTCGGCTACCAGGTGCAGTACGGCGAGACCGATTT
CGCGTTCATCCAGCGGCTGATGCAGGAGCACGGCATCTACTGGTTTTTCGAGCATACGAACCAGGTGCAC
CGGATGGTGCTCGTCGATCACCTGGGCGCGCACAAGCCGGTGGAGAGCGCCGCATACCGCACGCTGCGCT
ACTACCCGCCGGGGCACAAGATCGACGCCGAGTACATCGACAGGTTCAGCACCGAGGAGCACATCCGGCC
GGGCCGCTGGGCGACGGGCGATTTCGATTTCGAGAAGCCGAACGCGGACCTGGGCGTCGAGAACGCGCTG
CCGCGGGACACCGCGCACAACGGGCTCGAACGTTACGAGTGGCCGGGCGACTACACGGCGCGCGAGCACG
GCGAGCACCTCGCGCGCGTGCGCATGGAACAGACGCGCGCGCGGGGCGAGCGCGCATCGGGCGGCGGCAA
CGTGCGCGACATCGTGTGCGGCACGACATTCGCGCTCGCGGGCCATCCGCACGCGAGCGCGAACCGCGAG
TATCTGGTGATCGGCGCGACGTTCGAGGCGACGGAGACGGTCGGCGCGTCGGGGCCGGGCGCATATCGGA
TCGACACGTCGTTCGTCGCGCAGCCGGCGACCACCGCGTTCCGGCCGCCGCGCACGGTGCGCAAGCCGCG
CACGCGCGGGCCGCAGACGGCGATCGTCACCGGCCCGCGAGGGCAGGACATCTGGACGGACCAGTACGGC
CGTGTGAAGCTGAAATTCCACTGGGACCGTTCGCTCGTCGACGATCAGAACTCGTCGTGCTGGGTGCGCG
TTTCCTATGCGTGGTCGGGCAACAATTACGGCGGCGTCAATATTCCGCGTGTGGGCTCCGAAGTGGTCGT
CGATTTCGAGCACGGCGACCCGGACCGGCCGCTCGTGACGGGGCAGGTATACAACGCGCTGCACATGCCG
CCGTGGCCGTTGCCGGAGAACGCGACGCAAAGCGGCTTCATGACGCGCTCGCCCGCGGGCGGCGGCGAGA
ACGCGAACATGCTGCGCTTCGAGGACAAGGCGGGCGAGGAGCAGGTCAAGCTGCATGCGGAGCGCAATTA
CGACGTATCGGTCGAGCGCGACGCGACGACTGCCGTCGGGCGCAAGCACCTGACGCTCGTCGGCGTCGAC
CTGATGCCGGTGATGTCGACGCGCTCGCCGCTGGAGCGGCTGATCGACCTGCTGCGCACGGGCGGCGCGG
CCAGCCCGGCGGCGTCGGGGCAGCCGGCGGCGGCTTCCCGGCAACCGTCGGGACAGCAGCAGCAACATCA
ACAGCAACACCAGCAACATCAGCGGCAACACCAGCCCTATCAGCAGTTGAAGCAGCAGCGCCAGATGCAG
CGCGCGGGCGGATGGCAGGCGCTCGCGGCGAACGTCGCGAAGACGTTGCAGGAAATCGTGGCGGTGCTCA
CGGACCCGTTCGTCACCGCGTCGGTGAGCACCGTGCAGGGCGCGTCGACGTCCGTCGTGTTCGGCGACGC
GAAGGGCGTGCACGTGGGCGATACCGTCAAGATCACCAGCGGAGACGCGCATTCGGAGGTCAACGGCACG
GCATCGTCGAAGGACGTGAACAGTGTCTCGCTGAAGGGCACGTCGACCAGCCTGACCGGGGTCAGCACCT
CCGAAACGGGGACGAACATCGTGACGACCGGACTCACGGTATCAACGACCGGCGCGAGCGTTTCGACGAC
CGGATTCAGTGCGACCGAAACGCTCGTGCAGGTCGCCAAGAAGACGCAGGAATGCGAATTCATCAAGGGC
ATCAAGATCTCGATGTGA