SecReT6
Protein ID: 53716350
SecReT6 ID68
T6SS typei3
Gene symbol-
Locus tagBMAA0397
StrainBurkholderia mallei ATCC 23344
Repliconchromosome II [GenBank: NC_006349] [Browse all T6SS(s) in this replicon]
Location [Strand]384323..385726 [+]
Producthypothetical protein
NoteTssK
UniProt IDQ62DN5
KEGG IDbma:BMAA0397
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.60E-159, Aligned region: 30..466
Protein Sequence: 467 a.a.     [Download]
>gi|53716350|ref|YP_105193.1| unnamed protein product [Burkholderia mallei ATCC 23344]
MNEPVLSATPAAALRQRVIWTEGMFLRPQHFQQLERHWERYVGMRCLPLQGFYWGYDELQIDRELLALGK
VALLAATGVMRDGTPFDLSHPDDRPEPLDVPADAKDQLVVLALPLWRGGAQEVSFGAGGNGEGHGGDGNA
HAGFARYVVREYEVADANEVALGPALLQTGRLNVRLMLESELTGDWQALGVARVVERRTDGRLLVDDGYI
PPRLVAQRDPVLLRHTRELHGLLTQRSEALGERLSEPGRGGVSEVADFLLLQLVNRYLALTWHAQQDVAA
HPETLFCDWLKLACDLSTFTAAGRRPQSLAVYRHDDLRASFGELMAELRRSLSTVLEQNAIQIELRDVGN
GMKVATIADPALRDTAGFVLAVRADVPADSLRARFPAQAKLGPVERIRDLVQLQLPGIAMRQLPVAPRQI
PYHAGHTYFEIDKGGEMWKQLERSGGLAFHFAGEFPGLSMEFWAIRG
 
Nucleotide Sequence: 1404 bp     [Download]
>gi|77358719|ref|NC_006349.2|:384323-385726 Burkholderia mallei ATCC 23344 chromosome 2, complete sequence
ATGAACGAGCCGGTATTGTCCGCGACCCCCGCTGCGGCGTTGCGCCAGCGCGTGATCTGGACCGAGGGCA
TGTTCCTGCGGCCGCAGCATTTCCAGCAGCTCGAGCGGCACTGGGAGCGCTACGTCGGCATGCGCTGCCT
GCCGCTGCAAGGCTTCTACTGGGGCTACGACGAGTTGCAGATCGATCGCGAGCTGCTCGCGCTCGGCAAG
GTCGCGCTGCTCGCCGCGACCGGCGTGATGCGCGACGGCACGCCGTTCGACCTGTCGCATCCGGACGACC
GGCCCGAGCCGCTCGACGTGCCCGCCGACGCGAAGGATCAGCTCGTCGTGCTCGCGCTGCCGCTGTGGCG
CGGCGGCGCGCAGGAGGTGTCGTTCGGCGCGGGCGGCAACGGCGAAGGCCACGGCGGCGACGGCAACGCG
CACGCGGGCTTCGCGCGCTACGTCGTGCGCGAATACGAAGTCGCCGACGCGAACGAGGTCGCGCTCGGCC
CCGCGCTATTGCAGACCGGCCGCCTGAACGTGCGCCTGATGCTCGAATCCGAATTGACGGGCGACTGGCA
GGCGCTCGGCGTCGCGCGCGTCGTCGAGCGGCGCACCGATGGGCGGCTGCTCGTCGACGACGGCTACATT
CCGCCGCGGCTTGTCGCGCAGCGCGATCCGGTGCTGCTGCGCCACACGCGCGAGCTGCACGGGCTGCTCA
CGCAACGCAGCGAGGCGCTCGGCGAGCGCCTGTCGGAGCCGGGGCGCGGCGGCGTGTCCGAAGTCGCCGA
TTTCCTGCTGCTGCAACTCGTCAACCGCTATCTGGCGCTCACGTGGCACGCGCAGCAGGATGTCGCCGCG
CACCCGGAGACGCTGTTCTGCGATTGGCTGAAGCTCGCGTGCGACCTGAGCACGTTCACCGCGGCCGGCC
GCCGGCCGCAGTCGCTCGCGGTCTACCGGCACGACGATCTGCGCGCGAGCTTCGGCGAGCTGATGGCCGA
GCTGCGCCGCTCATTGTCGACGGTGCTCGAGCAGAACGCGATCCAGATCGAGCTGCGCGACGTGGGCAAC
GGCATGAAGGTCGCGACGATCGCCGATCCGGCGCTGCGCGACACCGCGGGCTTCGTGCTCGCCGTGCGCG
CCGACGTGCCGGCCGACAGCCTGCGCGCGCGCTTTCCCGCGCAGGCGAAGCTCGGTCCCGTCGAGCGCAT
TCGCGATCTCGTGCAGTTGCAACTGCCGGGCATCGCGATGCGGCAGTTGCCCGTCGCGCCGCGGCAGATT
CCGTATCACGCGGGCCACACGTACTTCGAGATCGACAAGGGCGGCGAGATGTGGAAACAGCTCGAACGCT
CGGGCGGCCTCGCATTTCATTTCGCCGGCGAATTCCCGGGACTCTCGATGGAGTTCTGGGCGATTCGCGG
GTGA