SecReT6
Protein ID: 53716351
SecReT6 ID68
T6SS typei3
Gene symbol-
Locus tagBMAA0396
StrainBurkholderia mallei ATCC 23344
Repliconchromosome II [GenBank: NC_006349] [Browse all T6SS(s) in this replicon]
Location [Strand]383787..384326 [+]
Productlipoprotein
NoteTssJ
UniProt IDQ62DN6
KEGG IDbma:BMAA0396
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.60E-38, Aligned region: 21..167
Protein Sequence: 179 a.a.     [Download]
>gi|53716351|ref|YP_105192.1| unnamed protein product [Burkholderia mallei ATCC 23344]
MQGKRPKMRPRFSVSVVLGCALLLAGCGATERSVAVPYSITLDVAPDVNPDLNRKPSPIVLKVFQLKTAS
AFESADFFSLQDKPQSVLGADLLGVDRIILRPGDARTLHYRGNVDAGAIGIVAEYRVLEKNRWRMTVPLP
RAKQLNLYRFWQTSPGEMKLQVAVKNGGIGLGGDSRVRQ
 
Nucleotide Sequence: 540 bp     [Download]
>gi|77358719|ref|NC_006349.2|:383787-384326 Burkholderia mallei ATCC 23344 chromosome 2, complete sequence
ATGCAAGGAAAGAGACCGAAAATGCGACCGCGGTTCAGTGTTTCCGTCGTTCTGGGATGCGCGCTGCTGC
TTGCCGGATGCGGGGCGACCGAGCGTTCCGTTGCGGTGCCGTATTCGATCACGCTCGACGTCGCGCCCGA
CGTCAATCCGGACCTCAATCGCAAGCCGTCGCCGATCGTGCTGAAGGTGTTCCAGCTGAAGACGGCGTCC
GCGTTCGAAAGCGCCGATTTCTTCTCGCTGCAGGACAAGCCGCAGAGCGTGCTCGGCGCGGATCTGCTCG
GCGTCGACCGGATCATCCTGCGCCCGGGGGATGCGCGCACGCTGCACTATCGCGGCAACGTCGACGCGGG
CGCGATCGGCATCGTCGCCGAATATCGCGTGCTCGAGAAGAACCGCTGGCGGATGACGGTGCCGCTGCCG
CGCGCGAAGCAACTGAACCTGTACCGATTCTGGCAAACCTCGCCGGGCGAGATGAAGCTGCAGGTCGCCG
TGAAGAACGGCGGCATCGGCCTCGGCGGCGATTCGCGAGTACGCCAATGA