SecReT6
Protein ID: 53716506
SecReT6 ID69
T6SS typei3
Gene symbol-
Locus tagBMAA0453
StrainBurkholderia mallei ATCC 23344
Repliconchromosome II [GenBank: NC_006349] [Browse all T6SS(s) in this replicon]
Location [Strand]454103..455818 [+]
Producthypothetical protein
NoteTssL
UniProt IDQ62DK0
KEGG IDbma:BMAA0453
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.00E-42, Aligned region: 141..336
OmpA [PF00691], Evalue: 5.10E-10, Aligned region: 395..502
Protein Sequence: 571 a.a.     [Download]
>gi|53716506|ref|YP_105228.1| unnamed protein product [Burkholderia mallei ATCC 23344]
MSLLRNLSSTLRRVSMASNMLDRAAANPDLVTRVPTLSSLSSAAMTSSAVSTTGTTNTVASGGAAAGAPS
FAPPAADAFPQADGAPRNPAVLQFPVPGGAPAPADARVAAPVVYSAQGEQAAIMKAGLQQASWNNPFVSH
ALPAVLQLQRHLAAGPLNQAAIRTQLGLEVRLYRERLAASGCEWEQIRDASYLLCTYLDETVNDAAREHA
QVVYDGERSLLVEFHDDAWGGEDAFADLSRWMKTEPPPIPLLSFYELILSLGWQGRYRVLDRVDVLLQDL
RSQLHALIWHHVPPEPLGTELVAPAKRRRSWWTAGRAAAVALGVLVLAYGAISFWLDSQGRPIRNALAAW
MPPTRTINIAETLPPPLPQILTEGWLTAYKHPQGWLLVFKSDGAFDVGKANVRADFMHNIERLGLAFAPW
PGDLEVIGHTDSRPIRTSEFPDNQALSEARARNVADELRKTALPGGARAPENAVQRNIEYSGRGDAQPID
TAKTAAAYERNRRVDVLWKVIPDGAQQSGRSLNLQQPEKPGQVPMRPAMPEGVEIAPDGQLPYATSTTMP
ATRPTTEGRQP
 
Nucleotide Sequence: 1716 bp     [Download]
>gi|77358719|ref|NC_006349.2|:454103-455818 Burkholderia mallei ATCC 23344 chromosome 2, complete sequence
ATGAGCCTGCTACGAAACCTCTCCTCCACGCTGCGCCGCGTATCGATGGCATCCAACATGCTCGATCGCG
CGGCGGCGAATCCGGATCTCGTGACGCGCGTGCCGACGCTGTCGTCGCTGTCGAGCGCGGCGATGACGAG
CTCCGCCGTATCGACCACCGGCACGACGAACACGGTGGCGTCGGGCGGCGCGGCCGCGGGCGCGCCGAGC
TTCGCGCCGCCGGCCGCCGACGCGTTTCCCCAAGCCGACGGCGCGCCCCGCAACCCCGCGGTGCTGCAAT
TCCCGGTGCCGGGCGGCGCGCCCGCGCCCGCCGACGCGCGGGTGGCCGCGCCCGTCGTCTATAGCGCGCA
GGGCGAGCAGGCCGCGATCATGAAAGCAGGCCTGCAGCAGGCGAGCTGGAACAACCCGTTCGTGTCGCAC
GCGCTGCCCGCGGTGCTGCAACTGCAGCGCCACCTCGCGGCCGGCCCGCTCAATCAGGCCGCGATCCGCA
CGCAGCTCGGCCTCGAGGTGCGGCTCTACCGCGAGCGGCTCGCCGCCTCCGGCTGCGAATGGGAGCAGAT
CCGCGACGCATCGTACCTGCTCTGCACGTATCTCGACGAAACCGTCAACGACGCGGCGCGCGAGCACGCG
CAAGTCGTCTACGACGGCGAGCGCAGCCTGCTCGTCGAATTCCACGACGACGCGTGGGGCGGCGAGGACG
CGTTCGCCGACCTGTCGCGCTGGATGAAGACCGAGCCGCCGCCGATTCCGCTTCTGTCGTTCTACGAACT
GATCCTGTCGCTCGGCTGGCAGGGCCGCTACCGCGTGCTCGACCGCGTCGACGTGCTGCTGCAGGATCTG
CGCTCGCAACTGCACGCGCTGATCTGGCATCACGTGCCGCCCGAGCCGCTCGGCACCGAGCTCGTCGCGC
CCGCGAAGCGGCGCCGCTCGTGGTGGACGGCCGGGCGCGCGGCGGCCGTCGCGCTCGGCGTGCTGGTGCT
CGCGTACGGCGCGATCAGCTTCTGGCTCGATTCGCAGGGCCGCCCGATCCGCAACGCGCTCGCCGCGTGG
ATGCCGCCCACGCGCACGATCAACATCGCCGAGACGCTGCCGCCGCCGCTGCCGCAGATTCTCACCGAAG
GGTGGCTCACCGCGTACAAGCATCCGCAAGGATGGCTGCTCGTGTTCAAGAGCGACGGCGCGTTCGACGT
TGGCAAGGCGAACGTGCGGGCGGACTTCATGCACAACATCGAGCGGCTCGGCCTCGCGTTCGCGCCGTGG
CCGGGCGACCTCGAGGTGATCGGCCACACCGATTCGCGGCCGATCCGCACGAGCGAGTTCCCGGACAACC
AGGCGCTGTCCGAAGCGCGGGCGCGCAACGTCGCCGACGAACTGCGCAAGACCGCGCTGCCGGGCGGCGC
GCGCGCGCCGGAGAACGCGGTGCAGCGCAACATCGAGTACTCGGGGCGCGGCGACGCGCAGCCGATCGAC
ACCGCGAAGACGGCCGCCGCGTACGAGCGCAACCGCCGCGTCGACGTGCTGTGGAAGGTGATTCCCGACG
GCGCGCAGCAATCGGGCCGCAGCCTGAACCTGCAGCAGCCGGAGAAGCCCGGGCAGGTGCCGATGCGTCC
GGCGATGCCGGAGGGCGTGGAGATCGCGCCTGACGGGCAACTGCCGTATGCGACGTCAACCACGATGCCA
GCAACGCGACCGACCACGGAGGGCCGTCAGCCATGA