SecReT6
Protein ID: 53716549
SecReT6 ID69
T6SS typei3
Gene symbol-
Locus tagBMAA0445
StrainBurkholderia mallei ATCC 23344
Repliconchromosome II [GenBank: NC_006349] [Browse all T6SS(s) in this replicon]
Location [Strand]442979..445225 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDQ62DK5
KEGG IDbma:BMAA0445
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.30E-70, Aligned region: 23..328
Phage_GPD [PF05954], Evalue: 4.30E-70, Aligned region: 677..705
Phage_base_V [PF04717], Evalue: 3.40E-23, Aligned region: 366..459
Protein Sequence: 748 a.a.     [Download]
>gi|53716549|ref|YP_105223.1| unnamed protein product [Burkholderia mallei ATCC 23344]
MRLIELRSPLLDPDAVALSFVVHESLSQEPSYQLDLLSHDPDLDFDALFGSTLSADIDLGEGDIRTFNTH
VFGGYDTGQMSGQYTYTLELRSWLSFLAENRNSRIFQNMSVPQIVEQVFQGHQRNGYRFELEGTYEPREY
CVQFQETDLNFVKRLLEDEGIYFWVEHEPDRHVVVISDTQRFEDLPLPNDTLEYLPDGEESRAIQGREGV
QRLQRTRRIKSNNVALRDFDYHAPSNKLDSDAQQVSPPNLEGIPLEYYDYAAGYREPEQGERLARLRLEA
IQAESHTLVGEANARALATGRAFTLIGHPALGRNRRYYVTNSELTFIQDGPDSTSQGRNVAVKFRALADD
QPFRPLLTTPRPEVPGIQSATVVGPEMSEVHTDKLGRIRVHFHWDRYKTTEADASCWIRVSQAWAGKGWG
VIAMPRVGQEVLVTYVDGDLDRPLVTGIVYNGENPTPYDLPKDIRYTGLVSRSIKRAGGYQNASQITFDD
QRGAERVMIHAERDMQQTVERNSSTSVVGISISFTGISVSYTGLSVSFTGVSASFTGVSTSFTGVSTSFT
GVSTSFTGVDTGFKGVSTSFTGVDTSFKGVSTSFTGVSTSLTGSSNSVTGVSNSMTGISSSWTDVSMSTT
GQSQSITGVSLSYTGTSNSMTGTSTSVTGTSTSITGTSMSNTGSSTSITGTSMSTTGSSTSVTGSSVSTT
DSSVSTTGSSVSTTGSSVSTTGFSFSYTGVSYSDTGIDLKKVGMQVKS
 
Nucleotide Sequence: 2247 bp     [Download]
>gi|77358719|ref|NC_006349.2|:442979-445225 Burkholderia mallei ATCC 23344 chromosome 2, complete sequence
ATGCGTCTGATCGAACTGCGCAGTCCCCTGCTGGACCCGGATGCGGTGGCGCTGAGCTTCGTGGTGCACG
AGAGCTTGTCGCAGGAGCCGTCGTATCAACTGGATCTGCTGAGCCACGACCCGGATCTGGACTTCGACGC
GCTGTTCGGCTCGACGCTGTCGGCCGACATCGACCTGGGCGAAGGCGACATCCGGACGTTCAACACGCAC
GTGTTCGGCGGCTACGACACGGGGCAGATGAGCGGGCAATACACGTACACGCTGGAGCTGCGAAGCTGGC
TGTCGTTTCTCGCGGAGAACCGCAACAGCCGGATCTTCCAGAACATGAGCGTGCCGCAGATCGTCGAGCA
GGTGTTCCAGGGCCATCAGCGCAACGGCTACCGGTTCGAGCTCGAAGGTACGTACGAGCCGCGCGAGTAC
TGCGTGCAGTTTCAGGAAACGGATCTGAACTTCGTGAAGCGGCTGCTGGAGGACGAAGGGATCTACTTCT
GGGTGGAGCACGAGCCGGATCGTCATGTGGTGGTGATCTCGGACACGCAGCGGTTCGAGGATCTGCCGCT
GCCGAACGACACGCTGGAGTATCTGCCGGACGGCGAGGAGTCGCGCGCGATCCAGGGGCGCGAAGGGGTG
CAGCGGCTGCAGCGCACGCGGCGGATCAAGTCGAACAACGTCGCGCTGCGGGATTTCGACTATCACGCGC
CGTCGAACAAGCTCGACAGCGACGCGCAGCAGGTGTCGCCGCCGAACCTCGAGGGGATTCCGCTCGAGTA
TTACGACTATGCGGCGGGCTACCGCGAGCCCGAGCAGGGCGAGCGTCTCGCGCGGCTGCGGCTCGAGGCG
ATTCAGGCGGAATCACACACGCTGGTGGGCGAGGCGAACGCGCGCGCGCTGGCCACGGGCCGGGCGTTCA
CGTTGATCGGGCATCCGGCGCTGGGGCGCAATCGTCGGTACTACGTGACGAACAGCGAGCTGACGTTCAT
CCAGGACGGACCGGACAGCACGTCGCAGGGGCGCAACGTCGCGGTGAAGTTCCGCGCGCTTGCCGACGAT
CAGCCGTTTCGGCCGCTGTTGACGACGCCGCGTCCCGAAGTGCCGGGTATCCAGAGCGCGACGGTGGTGG
GTCCGGAGATGTCGGAAGTGCATACCGACAAGCTCGGGCGGATTCGCGTGCATTTCCATTGGGACCGCTA
CAAGACGACCGAGGCGGATGCGTCGTGCTGGATACGCGTGTCGCAGGCATGGGCGGGCAAGGGCTGGGGC
GTGATCGCGATGCCGCGGGTCGGGCAGGAAGTGCTCGTCACGTATGTCGACGGCGATCTCGATCGGCCGC
TCGTGACGGGCATCGTCTACAACGGCGAGAACCCGACGCCTTATGACTTGCCGAAGGACATCCGCTACAC
GGGGCTGGTGTCGCGTTCGATCAAGCGTGCGGGCGGTTATCAGAACGCGAGTCAGATCACGTTCGATGAC
CAGCGCGGCGCGGAGCGCGTGATGATCCACGCGGAGCGCGACATGCAGCAGACGGTCGAGCGCAACAGCT
CGACGTCGGTCGTCGGCATCTCGATTAGCTTCACGGGCATCTCGGTGTCGTACACGGGGTTGTCGGTGAG
CTTCACCGGCGTGTCGGCGAGCTTCACGGGCGTGAGCACGTCGTTTACCGGCGTGAGCACGAGTTTCACC
GGCGTGTCGACGTCGTTTACCGGCGTCGACACCGGCTTCAAGGGCGTGTCGACGTCGTTTACCGGTGTCG
ATACCAGCTTCAAGGGTGTGTCGACTTCGTTCACGGGCGTAAGCACGAGCCTCACCGGTTCGAGCAACTC
GGTGACGGGCGTATCGAACAGCATGACGGGCATCTCGTCATCATGGACCGACGTCAGCATGTCGACGACC
GGCCAATCCCAAAGCATCACGGGGGTATCGCTGTCGTACACGGGCACGTCGAACAGCATGACGGGCACGA
GCACGTCGGTGACGGGCACCTCGACGAGCATCACCGGCACGTCGATGTCGAACACCGGCAGCTCGACGAG
CATCACGGGCACGTCGATGTCGACGACGGGCAGCTCGACGAGCGTCACCGGCTCGAGCGTATCGACGACC
GACAGCTCGGTGAGCACGACGGGCTCGAGCGTGTCGACAACGGGCAGCAGCGTGTCGACGACGGGTTTCA
GCTTCTCGTACACCGGCGTCAGCTATTCGGACACCGGTATCGACCTGAAGAAGGTCGGCATGCAAGTGAA
GAGCTGA