SecReT6
Protein ID: 53716556
SecReT6 ID69
T6SS typei3
Gene symbol-
Locus tagBMAA0439
StrainBurkholderia mallei ATCC 23344
Repliconchromosome II [GenBank: NC_006349] [Browse all T6SS(s) in this replicon]
Location [Strand]434560..436071 [+]
Producthypothetical protein
NoteTssC
UniProt IDQ62DK6
KEGG IDbma:BMAA0439
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.80E-183, Aligned region: 69..495
Protein Sequence: 503 a.a.     [Download]
>gi|53716556|ref|YP_105222.1| unnamed protein product [Burkholderia mallei ATCC 23344]
MSMQQLESSAEKVVVDQNNVNEDLKDILRRSFRPRTNEAAEAVQNAVETLLTYARRSRVVVREDVAQTIE
QLVAELDKKISEQLTLVLHNKRFQSLEGAWRGLHYLVSNTDTSENLKIRYLNISKADLGKTLRRFKGVVW
DQSPIFKMIYEQEYGQFGGEPFGCLIGDFYFDHSMQDVSILTEMSKISAAAHAPFIAAAAPGLLQMDDWS
ELSNPRDVSKIFTATEYAFWRRLRESNDSRYLALTLPRFLARVPYGPKTQPVEEFGFEEKVDPNRAEDFC
WANSAYAMGANITRAFKTYGWCTKIRGVESGGAVEVLPKFVLPSQDREVDLHCPTEIAISDRREHELSES
GLMPLVYRKNSDTAAFIGAKTVHRPAIYEDDDATANSNLSSRLPYIFATCRFAHYLKCIVRDKIGSFKSA
EDTQRWLNDWLMNYVDGDPSISSEVTKSQRPLSAAEVVVDEIPENPGYYRAQFFLRPHFQLEGLTVSLRL
VSKLPSTKHEVTT
 
Nucleotide Sequence: 1512 bp     [Download]
>gi|77358719|ref|NC_006349.2|:434560-436071 Burkholderia mallei ATCC 23344 chromosome 2, complete sequence
ATGAGTATGCAGCAGCTTGAATCGTCTGCCGAGAAGGTGGTCGTCGATCAGAACAACGTCAACGAGGATC
TGAAGGACATCCTGCGCCGCTCGTTCCGGCCGCGCACCAACGAGGCGGCCGAGGCGGTGCAGAACGCGGT
CGAGACGCTGCTCACGTATGCGCGGCGCAGCCGGGTCGTGGTTCGTGAGGATGTCGCGCAGACGATCGAG
CAGCTGGTTGCCGAGCTCGACAAGAAGATCTCCGAGCAACTGACGCTCGTGCTGCACAACAAGCGCTTTC
AGAGCCTCGAAGGCGCGTGGCGCGGATTGCACTACCTCGTGTCGAACACCGATACGAGCGAGAACCTGAA
GATCCGCTACCTGAACATCTCGAAAGCGGATCTCGGCAAGACGCTGCGGCGCTTCAAGGGCGTCGTGTGG
GATCAGAGTCCGATTTTCAAGATGATCTACGAGCAGGAGTACGGCCAGTTCGGCGGCGAGCCGTTCGGCT
GCCTGATCGGCGACTTCTATTTCGACCACAGCATGCAGGACGTGTCGATCCTCACCGAGATGTCGAAGAT
CTCGGCGGCCGCTCACGCGCCGTTCATCGCGGCTGCCGCGCCCGGCCTGCTGCAGATGGACGACTGGAGC
GAGCTGTCGAACCCGCGCGACGTGTCGAAGATCTTCACGGCGACCGAGTATGCGTTCTGGCGGCGCCTGC
GCGAGAGCAACGACTCGCGCTACCTCGCGCTCACGCTGCCGCGCTTCCTCGCGCGTGTGCCGTATGGTCC
GAAGACGCAGCCCGTCGAAGAGTTCGGCTTCGAGGAGAAGGTCGATCCGAACCGCGCGGAGGATTTCTGC
TGGGCGAACTCCGCGTATGCGATGGGCGCGAACATCACGCGCGCGTTCAAGACCTACGGCTGGTGCACGA
AGATTCGCGGCGTCGAGTCGGGCGGCGCGGTCGAGGTGCTGCCGAAGTTCGTGCTGCCGTCGCAGGATCG
CGAAGTCGATCTGCATTGCCCGACCGAGATCGCGATCTCGGACCGCCGCGAGCACGAATTGTCCGAGTCG
GGCCTGATGCCGCTCGTGTATCGGAAGAATTCGGATACGGCCGCGTTCATCGGCGCGAAGACCGTGCATC
GTCCGGCGATCTACGAGGACGACGACGCGACCGCGAACTCGAACCTGTCGTCGCGGCTGCCGTACATCTT
CGCGACCTGCCGTTTCGCGCATTACCTGAAGTGCATCGTGCGCGACAAGATCGGTTCGTTCAAGTCGGCC
GAGGACACGCAGCGCTGGCTCAACGACTGGCTGATGAACTACGTGGACGGCGACCCGAGCATCTCGAGCG
AGGTGACGAAGTCGCAGCGTCCGCTGTCGGCGGCGGAGGTGGTCGTCGACGAGATTCCGGAAAACCCCGG
CTACTATCGCGCGCAGTTCTTCCTGCGCCCCCATTTCCAACTGGAGGGTTTGACCGTTTCTCTCCGGCTG
GTTTCGAAGCTTCCGTCGACCAAGCACGAGGTGACGACCTGA