SecReT6
Protein ID: 53717376
SecReT6 ID70
T6SS typei1
Gene symbol-
Locus tagBMAA0747
StrainBurkholderia mallei ATCC 23344
Repliconchromosome II [GenBank: NC_006349] [Browse all T6SS(s) in this replicon]
Location [Strand]765507..767435 [+]
Producthypothetical protein
NoteTssA
UniProt IDQ62CV7
KEGG IDbma:BMAA0747
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.90E-18, Aligned region: 67..126
ImpA-rel_N [PF06812], Evalue: 2.90E-18, Aligned region: 602..612
Protein Sequence: 642 a.a.     [Download]
>gi|53717376|ref|YP_105471.1| unnamed protein product [Burkholderia mallei ATCC 23344]
MSERRPPGGAAARARMPIDVQALAVLGRTDIDSAMPAGADVRADARFDALHAELAKLASPGASGQVDWRA
ATHLAAELLRERGKDLLVGCYLAGALLQTGGAAGLRCGLEIVGDLVERHWDAMSPPVSRMRARRGALQWL
VDRVDAMHDAGAAACGGACSAELVAQLRAAARRIDALLAERDDDAPTMRAVHAFAERLPVEVVEVVEVAD
EADVAEAAEAAEAAEAAEAAEAAEAAEAAEAAEAAEAAEAADVADVADVAETAEADAHGSTGGPAAEIAI
AAAEQALIDPAGRAAPSAGTDTNANADAARQPARLDEAAGRDRALADALAQLHCVATAFAQADWADARGF
RLRRVACWSSVCALPETDAENGRTRIAAPSASIVGAAKNIDEDGEPVAAVRFAEAHAQAFPLWLDLQRIA
ARALARAGGDGADARREVETAVRALLARLPGLDALTFADGTPFADDATRAWLGELGAPVVAADAVSPSSL
PLSPRPSPPERSSPMAGEPARAPGDACGASADDAVDRACAFAASGQLDLALHAIQHAIDRATSAEQRLRA
RVRLCELARDHWPHEVPEAFARGVIEPIRRHDLLAWNPELALDGLSAAYALLIRRDRESAHARTVLDEIA
SVDAARAMRLSM
 
Nucleotide Sequence: 1929 bp     [Download]
>gi|77358719|ref|NC_006349.2|:765507-767435 Burkholderia mallei ATCC 23344 chromosome 2, complete sequence
ATGAGCGAACGGCGCCCGCCCGGCGGCGCGGCGGCGCGCGCGCGCATGCCGATCGATGTCCAAGCGCTCG
CCGTGCTGGGGCGCACGGACATCGATTCCGCCATGCCCGCGGGCGCCGACGTGCGCGCCGACGCGAGGTT
CGACGCGCTGCACGCGGAGCTTGCGAAGCTCGCGTCGCCGGGCGCGAGCGGGCAAGTCGATTGGCGCGCG
GCGACGCATCTCGCCGCCGAATTGCTGCGCGAGCGCGGCAAGGATTTGCTCGTCGGCTGCTATCTGGCGG
GTGCGTTGCTGCAGACGGGCGGCGCGGCGGGGCTGCGCTGCGGACTCGAAATCGTCGGCGATCTCGTCGA
ACGTCATTGGGATGCGATGTCGCCGCCCGTGTCGCGGATGCGGGCGAGGCGCGGGGCGCTGCAATGGCTG
GTCGATCGCGTCGACGCCATGCACGATGCAGGAGCCGCGGCATGCGGCGGCGCGTGCTCGGCCGAACTGG
TCGCGCAATTGCGCGCGGCCGCGCGGCGCATCGATGCGCTGCTCGCCGAGCGTGACGACGACGCGCCGAC
GATGCGCGCGGTGCATGCGTTCGCGGAGCGATTGCCTGTTGAGGTGGTTGAGGTGGTGGAAGTGGCTGAC
GAGGCTGATGTGGCTGAGGCGGCTGAGGCGGCTGAGGCGGCTGAGGCGGCTGAGGCGGCTGAGGCGGCTG
AGGCGGCTGAGGCGGCTGAGGCGGCTGAGGCGGCTGAGGCGGCTGAGGCGGCTGATGTGGCTGATGTGGC
TGATGTGGCTGAGACGGCCGAGGCCGATGCGCACGGCTCGACGGGAGGGCCGGCCGCGGAAATCGCGATT
GCCGCCGCCGAACAGGCTTTGATTGATCCGGCCGGTCGAGCCGCGCCGAGCGCCGGCACGGATACGAACG
CGAACGCAGACGCCGCCAGGCAACCGGCGCGGCTCGACGAAGCGGCCGGCCGCGACCGCGCGCTCGCCGA
TGCGCTCGCGCAATTGCATTGCGTCGCGACGGCGTTCGCGCAAGCGGACTGGGCCGACGCGCGCGGCTTC
CGGCTGCGCCGCGTCGCGTGCTGGTCGAGCGTGTGTGCGCTGCCGGAAACGGACGCGGAGAACGGAAGAA
CGCGGATCGCCGCGCCGAGCGCTTCGATCGTCGGCGCGGCGAAGAACATCGACGAGGATGGCGAGCCCGT
GGCGGCGGTGCGCTTCGCCGAAGCGCATGCGCAGGCGTTCCCGCTCTGGCTGGATTTGCAGCGCATCGCC
GCGCGCGCGCTCGCGCGCGCGGGAGGCGACGGCGCCGATGCGCGGCGCGAAGTGGAGACGGCGGTTCGTG
CACTGCTTGCGCGGCTGCCGGGCCTCGACGCGCTGACGTTCGCGGACGGCACGCCGTTCGCCGACGACGC
GACGCGCGCATGGCTCGGCGAGCTTGGCGCGCCTGTTGTGGCGGCGGATGCGGTGTCGCCGTCGTCTTTG
CCGCTTTCGCCGCGACCTTCGCCGCCTGAGCGATCGTCGCCGATGGCGGGCGAACCGGCGCGCGCGCCGG
GCGATGCGTGCGGGGCGAGCGCCGACGATGCAGTGGACCGAGCGTGCGCGTTTGCCGCGAGCGGCCAGCT
CGATCTCGCGCTCCACGCGATTCAGCATGCGATCGATCGTGCGACGAGCGCCGAACAGCGGTTGAGAGCG
CGCGTGCGGTTGTGCGAGCTTGCGCGCGACCATTGGCCGCATGAGGTTCCTGAGGCGTTCGCGCGCGGCG
TGATCGAACCGATTCGGCGGCACGATTTGCTCGCATGGAATCCGGAGCTGGCGCTCGACGGCTTGTCGGC
CGCCTATGCGCTGCTGATTCGGCGCGATCGCGAATCGGCGCACGCGAGGACGGTGCTTGACGAGATCGCG
AGCGTCGACGCGGCGCGGGCCATGCGTTTGTCGATGTGA