SecReT6
Protein ID: 53717587
SecReT6 ID70
T6SS typei1
Gene symbol-
Locus tagBMAA0733
StrainBurkholderia mallei ATCC 23344
Repliconchromosome II [GenBank: NC_006349] [Browse all T6SS(s) in this replicon]
Location [Strand]744827..745624 [-]
Producthypothetical protein
NoteTssJ
UniProt IDQ62CW5
KEGG IDbma:BMAA0733
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.50E-25, Aligned region: 46..208
Protein Sequence: 265 a.a.     [Download]
>gi|53717587|ref|YP_105463.1| unnamed protein product [Burkholderia mallei ATCC 23344]
MNARHIAPPAATRARRPMQPGRPSWPSRTYRACAARTCAAVLVALAALAGCAARVTEEQARADVRWDYAP
DALRIDIDASARLNEYLNAPHTLLLAVFQSADAKAFRQLADDPDRLRMTLAAGGPAADFIQTTRYVVAPG
QHVALSIDRAQQARYVGIVAGYYDADGPRAARLFEVPLRIDKRGWFSSTYRAAPRTLELKLRLGAQSITD
AREAPLNLPPPGARAWTALDSGAKTLALPSADANDGGSGKRDKRGNAAARAPRKQ
 
Nucleotide Sequence: 798 bp     [Download]
>gi|77358719|ref|NC_006349.2|:c745624-744827 Burkholderia mallei ATCC 23344 chromosome 2, complete sequence
ATGAACGCACGACACATTGCCCCGCCGGCCGCGACGCGCGCGCGCCGGCCGATGCAGCCCGGCCGGCCGT
CATGGCCGTCGCGAACGTATCGCGCATGCGCGGCTCGCACATGCGCTGCCGTGCTCGTCGCGCTCGCCGC
CCTCGCCGGCTGTGCGGCCCGCGTCACCGAAGAGCAGGCGCGCGCCGACGTGCGATGGGACTACGCGCCC
GACGCGCTGCGCATCGATATCGACGCGTCGGCGCGGTTGAACGAATACCTGAACGCGCCGCACACGCTGT
TGCTCGCGGTGTTCCAGAGCGCGGACGCGAAGGCGTTCCGCCAGCTCGCCGACGATCCGGACCGGCTGCG
CATGACGCTCGCGGCGGGCGGCCCCGCCGCGGACTTCATTCAGACGACCCGCTACGTCGTCGCGCCCGGC
CAGCATGTCGCGCTGTCGATCGATCGCGCGCAGCAGGCGCGCTACGTCGGCATCGTCGCCGGCTACTACG
ACGCCGACGGCCCACGCGCGGCGCGCCTGTTCGAGGTGCCGCTGCGCATCGACAAGCGCGGCTGGTTCTC
CTCCACCTATCGCGCCGCGCCGCGAACGCTCGAGCTGAAGCTCAGGCTCGGCGCGCAGAGCATCACCGAC
GCGCGCGAAGCGCCGCTGAACCTGCCGCCGCCGGGCGCGCGCGCATGGACGGCGCTCGACAGCGGCGCGA
AGACCCTGGCGCTGCCGAGCGCCGACGCGAACGACGGCGGCAGCGGCAAGCGCGACAAACGCGGCAACGC
CGCCGCCCGTGCGCCGCGCAAGCAATGA