SecReT6
Protein ID: 53721204
SecReT6 ID73
T6SS typei3
Gene symbol-
Locus tagBPSS0168
StrainBurkholderia pseudomallei K96243
Repliconchromosome II [GenBank: NC_006351] [Browse all T6SS(s) in this replicon]
Location [Strand]225502..226767 [-]
Producthypothetical protein
NoteTssL
UniProt IDQ63NY0
KEGG IDbps:BPSS0168
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.10E-68, Aligned region: 46..256
OmpA [PF00691], Evalue: 2.70E-17, Aligned region: 315..413
Protein Sequence: 421 a.a.     [Download]
>gi|53721204|ref|YP_110189.1| unnamed protein product [Burkholderia pseudomallei K96243]
MHHPDISAPAPTFDSVAATFARREPAPAPAGEPPAARLAAIRLARNPLLEAARVLLRALADMPERLDRDD
IPQLRLLLEQEVRLFQRLCEQANIRRDHMLGARYCLCTALDEAAMQTSWAQSASGNLGTWISEGLATSFH
EDRQGGDKVYLLIGRLMNSPHEHIDLLEVIYRILSLGFEGRYRYEADGQRKHETVRQRLYNEIASQRGPV
SVALSPHWQPGPRSRSAPFRDFPAWVTAAVLSLIALGLFGCFKYALSTRSADVQQRIAAIARMAPPAAPA
ELRLATLLAGEIAAGTLSVEENARRSSVTFRGDAMFAPGAAGVNPAMGPLIRKIAAEIAKVPGKVTVRGY
TDNQPIKSRQFASNEALSEERATQVMQMLQSAGVPASRLEALGKGGAEPIGDNRTPQGRALNRRVEITVA
R
 
Nucleotide Sequence: 1266 bp     [Download]
>gi|53721039|ref|NC_006351.1|:c226767-225502 Burkholderia pseudomallei K96243 chromosome 2, complete sequence
GTGCATCATCCGGACATATCGGCTCCGGCCCCGACCTTCGATTCCGTCGCGGCGACGTTCGCGCGGCGCG
AGCCGGCGCCTGCGCCGGCCGGCGAGCCGCCCGCCGCGCGCCTCGCCGCGATCAGGCTCGCCCGCAACCC
GCTGCTCGAAGCCGCGCGCGTGCTGCTGCGGGCGCTCGCCGACATGCCCGAGCGGCTCGATCGCGACGAC
ATTCCGCAATTGCGCCTGCTGCTGGAACAGGAGGTGCGCCTGTTCCAGCGGCTCTGCGAACAGGCGAACA
TCCGGCGCGACCACATGCTCGGCGCGCGCTACTGCCTGTGCACCGCGCTCGACGAGGCGGCGATGCAGAC
GTCGTGGGCACAATCGGCGAGCGGCAATCTCGGCACGTGGATCAGCGAGGGGCTCGCGACGTCGTTCCAC
GAGGATCGCCAGGGCGGAGACAAGGTCTATCTGCTGATCGGCCGGCTGATGAATTCGCCGCACGAGCACA
TCGACCTGCTCGAAGTCATCTATCGAATCTTGAGCCTCGGCTTCGAGGGCCGCTACCGTTACGAAGCCGA
CGGCCAGCGCAAGCACGAGACCGTGCGCCAGCGGCTCTACAACGAGATCGCATCGCAGCGCGGGCCGGTG
TCGGTCGCGCTGTCGCCGCACTGGCAGCCCGGCCCCCGCAGCAGGAGCGCGCCGTTTCGCGATTTCCCCG
CGTGGGTCACGGCCGCCGTGCTGTCGCTGATCGCGCTCGGGCTGTTCGGCTGCTTCAAGTACGCGCTGTC
GACGCGCAGCGCCGACGTGCAGCAGCGGATCGCCGCGATCGCGCGGATGGCGCCGCCCGCCGCGCCGGCC
GAGCTGCGCCTCGCGACGCTGCTCGCCGGCGAGATCGCGGCGGGCACGCTCAGCGTCGAGGAAAACGCGC
GCCGCAGCTCGGTGACGTTCCGCGGCGACGCGATGTTCGCGCCGGGCGCGGCCGGCGTGAACCCGGCGAT
GGGGCCGCTCATCCGGAAAATCGCGGCCGAGATCGCGAAGGTGCCGGGCAAGGTGACGGTGCGCGGCTAC
ACCGACAATCAGCCGATCAAAAGCCGCCAGTTCGCGTCGAACGAGGCGCTATCCGAAGAGCGCGCGACGC
AGGTCATGCAGATGCTCCAGAGCGCGGGCGTGCCCGCGAGCCGCCTCGAGGCGCTCGGCAAGGGCGGCGC
CGAGCCGATCGGCGACAACCGGACCCCGCAGGGCCGCGCGCTGAACCGCCGCGTCGAAATCACGGTCGCG
CGCTGA