SecReT6
Protein ID: 53721206
SecReT6 ID73
T6SS typei3
Gene symbol-
Locus tagBPSS0170
StrainBurkholderia pseudomallei K96243
Repliconchromosome II [GenBank: NC_006351] [Browse all T6SS(s) in this replicon]
Location [Strand]228224..228736 [-]
Productlipoprotein
NoteTssJ
UniProt IDQ63NX8
KEGG IDbps:BPSS0170
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.50E-40, Aligned region: 17..163
Protein Sequence: 170 a.a.     [Download]
>gi|53721206|ref|YP_110191.1| unnamed protein product [Burkholderia pseudomallei K96243]
MPRMHPTTPVAAVALALACAACASGAAKQKEPLRLELAVRAAPTVNPDDRSRPAPIVVSVYELKTDGAFN
AADFFTLQGPDKTVLADDLLARERFQLRPGERRVIRRDADPAAGALGVVAAYRDLPNSVWRAAYPLPPAR
DAAWYRFSSPKLKLTIELDTHAIRITEPGK
 
Nucleotide Sequence: 513 bp     [Download]
>gi|53721039|ref|NC_006351.1|:c228736-228224 Burkholderia pseudomallei K96243 chromosome 2, complete sequence
GTGCCTCGAATGCATCCGACCACCCCCGTTGCCGCCGTCGCGCTCGCGCTCGCGTGCGCCGCGTGCGCGA
GCGGCGCGGCCAAGCAGAAGGAGCCGCTGCGGCTCGAGCTCGCCGTGCGCGCCGCGCCCACGGTCAATCC
GGACGATCGGAGCCGGCCGGCTCCGATCGTCGTGAGCGTCTACGAGCTGAAGACCGACGGCGCATTCAAC
GCCGCCGATTTCTTCACGCTGCAGGGCCCGGACAAGACCGTGCTCGCCGACGATCTGCTCGCGCGCGAGC
GTTTTCAACTGCGCCCCGGCGAGCGCCGCGTGATCCGGCGCGACGCCGATCCGGCGGCGGGCGCGCTCGG
CGTCGTCGCCGCGTACCGCGATCTGCCGAACTCGGTGTGGCGCGCGGCATATCCGCTGCCGCCCGCGCGG
GACGCCGCATGGTATCGCTTCTCGTCGCCGAAGCTGAAGCTGACCATCGAGCTCGACACGCACGCGATCA
GGATCACCGAACCCGGAAAATGA