SecReT6
Protein ID: 53721212
SecReT6 ID73
T6SS typei3
Gene symbol-
Locus tagBPSS0176
StrainBurkholderia pseudomallei K96243
Repliconchromosome II [GenBank: NC_006351] [Browse all T6SS(s) in this replicon]
Location [Strand]235775..236740 [+]
Producthypothetical protein
NoteTagJ
UniProt IDQ63NX2
KEGG IDbps:BPSS0176
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 4.60E-51, Aligned region: 149..294
Protein Sequence: 321 a.a.     [Download]
>gi|53721212|ref|YP_110197.1| unnamed protein product [Burkholderia pseudomallei K96243]
MTTPAFPAPPGARTSARPHDTLLDARLAAAQAAVRARPVDAASRWALFQLLCVTGQWERAVGQLQAYARF
AAQHAHIAHAYRDLIRAERFRARVMAGQARPGFVFDAPPWIDDLLEALRAQAAGARDEADRARSRALDRA
PFVAGRGPDAPFDWIADSDSRFGPVCEVVTAGHDRWLPFSDLAGWRLARPGVLLALVWAPCVLTLADGSV
AHGFMPARYPGSELADGGGAPGASAAAHEADAHESAAREADALRLGSRTAWRDVGRTGVFALGRKTWSTS
AGDAGLFELHACEFGARARAGAVLGGAAREARGGEAADGCA
 
Nucleotide Sequence: 966 bp     [Download]
>gi|53721039|ref|NC_006351.1|:235775-236740 Burkholderia pseudomallei K96243 chromosome 2, complete sequence
ATGACGACGCCTGCCTTCCCGGCGCCGCCCGGCGCGCGCACGTCGGCCCGGCCGCACGATACGCTGCTCG
ACGCGCGGCTCGCGGCTGCGCAAGCCGCGGTGCGCGCCCGGCCCGTCGATGCGGCGAGCCGTTGGGCGCT
GTTTCAACTGCTCTGCGTGACGGGCCAGTGGGAACGCGCCGTCGGGCAGTTGCAGGCTTATGCGCGGTTC
GCCGCGCAGCACGCGCACATCGCGCACGCCTATCGCGACCTGATTCGCGCCGAGCGCTTTCGCGCCCGCG
TGATGGCGGGCCAGGCGCGGCCGGGATTCGTATTCGATGCGCCGCCGTGGATCGACGATCTGCTGGAAGC
GTTGCGCGCGCAGGCGGCCGGCGCGCGCGACGAAGCCGACCGCGCGCGTTCGCGCGCGCTCGATCGCGCG
CCGTTCGTCGCGGGGCGCGGGCCGGATGCGCCGTTCGACTGGATCGCCGACAGCGATTCGCGATTCGGGC
CGGTCTGCGAAGTCGTGACCGCCGGGCATGATCGTTGGCTGCCGTTTTCGGATCTGGCCGGATGGCGGCT
CGCGCGCCCGGGCGTGCTGCTCGCTCTGGTCTGGGCGCCGTGCGTGCTCACGCTTGCCGACGGCAGTGTC
GCGCACGGCTTCATGCCGGCGCGTTACCCGGGCTCCGAACTGGCCGACGGGGGCGGCGCGCCGGGCGCCT
CAGCGGCCGCGCACGAGGCCGATGCGCACGAGAGCGCCGCGCGCGAGGCCGATGCGTTGCGGCTCGGCAG
CCGGACCGCATGGCGCGACGTCGGCCGCACCGGCGTGTTCGCGCTCGGCCGCAAGACCTGGTCGACGAGC
GCGGGCGACGCCGGCCTTTTCGAGCTGCACGCGTGTGAATTCGGCGCGCGCGCCCGTGCGGGCGCCGTGC
TCGGCGGCGCGGCGCGCGAAGCGCGCGGCGGGGAGGCGGCCGATGGATGCGCATGA