SecReT6
Protein ID: 53721213
SecReT6 ID73
T6SS typei3
Gene symbol-
Locus tagBPSS0177
StrainBurkholderia pseudomallei K96243
Repliconchromosome II [GenBank: NC_006351] [Browse all T6SS(s) in this replicon]
Location [Strand]236781..237308 [+]
Producthypothetical protein
NoteTssE
UniProt IDQ63NX1
KEGG IDbps:BPSS0177
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.70E-18, Aligned region: 42..152
Protein Sequence: 175 a.a.     [Download]
>gi|53721213|ref|YP_110198.1| unnamed protein product [Burkholderia pseudomallei K96243]
MRGEGLATPRRANTQLLPTLIDRLRDDAPQRQTEAPGGYALTRMQMRGIVQRDLAFLLNTTSIDEHIDRE
RHPAAAASTLNFGVPPLAGAFLASCQWAEVERIIRRVILDFEPRLIAETLVVAPSRAAGAVARPNVLAFE
VRGMIRMDPYPIEFMVQSALDLETNQVNITGMRAS
 
Nucleotide Sequence: 528 bp     [Download]
>gi|53721039|ref|NC_006351.1|:236781-237308 Burkholderia pseudomallei K96243 chromosome 2, complete sequence
GTGCGCGGCGAAGGCCTCGCGACGCCGCGCCGCGCGAACACGCAACTGCTGCCGACGCTGATCGACCGCC
TGCGCGACGACGCGCCGCAACGGCAGACCGAAGCGCCCGGCGGATATGCGCTCACGCGCATGCAGATGCG
CGGCATCGTCCAGCGTGATCTCGCCTTCCTGCTCAACACGACGAGCATCGACGAGCACATCGATCGCGAA
CGCCATCCGGCCGCCGCCGCCTCGACGCTCAACTTCGGCGTGCCGCCGCTTGCCGGCGCGTTTCTCGCGT
CGTGCCAGTGGGCCGAGGTCGAACGCATCATCCGCCGCGTAATTCTCGATTTCGAGCCGCGGCTGATCGC
CGAGACGCTCGTCGTCGCGCCGTCGCGGGCCGCCGGCGCGGTCGCGCGCCCGAACGTGCTCGCGTTCGAG
GTGCGCGGCATGATTCGTATGGATCCCTATCCGATCGAATTCATGGTGCAAAGCGCGCTCGATCTCGAAA
CGAACCAGGTCAACATCACCGGCATGCGCGCGAGCTGA