SecReT6
Protein ID: 53721215
SecReT6 ID73
T6SS typei3
Gene symbol-
Locus tagBPSS0179
StrainBurkholderia pseudomallei K96243
Repliconchromosome II [GenBank: NC_006351] [Browse all T6SS(s) in this replicon]
Location [Strand]239240..240313 [+]
Producthypothetical protein
NoteTssG
UniProt IDQ63NW9
KEGG IDbps:BPSS0179
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.20E-100, Aligned region: 20..321
Protein Sequence: 357 a.a.     [Download]
>gi|53721215|ref|YP_110200.1| unnamed protein product [Burkholderia pseudomallei K96243]
MTQAAVADTALSPQALARLRAEPWRYGFLALLRRIGADARIDPIGKARRPQAEPFRLGQQPSLAFAPREI
ASVGDANGRLKVRLFGLGMLGPNGPLPIHVTEIARDREESRRDPTLGNFLDIFHHRYLTLLYRAWASAQA
VAGLDRPDDERFSFYVASLAGQDLDEVGAQPLPAHARLSASPHLVREARNADGLRMTLERYFGVPVTLEE
NVFHWIAVDPLEHSRLGRPGDASTMAAGALLGELVPDRQHKFRLVFGPLDIDAYLRFTPRGEDLPRLVEW
VRAFVGYEFEWELELRIKPNGAPPAVMGGPHQLGWSGWLGRSPSGEPVTGMRFEPEHYAHGFARGTARDT
RGMRGER
 
Nucleotide Sequence: 1074 bp     [Download]
>gi|53721039|ref|NC_006351.1|:239240-240313 Burkholderia pseudomallei K96243 chromosome 2, complete sequence
ATGACGCAGGCGGCCGTTGCCGACACGGCGCTGTCGCCGCAAGCGCTCGCGCGGCTGCGCGCCGAACCGT
GGCGCTATGGGTTCCTCGCGCTGCTGCGCCGCATCGGCGCGGACGCGCGCATCGATCCGATCGGCAAGGC
GAGGCGCCCGCAGGCGGAGCCGTTTCGCCTCGGCCAGCAGCCGAGCCTCGCGTTCGCGCCGCGCGAGATC
GCCAGCGTCGGCGACGCGAACGGGCGGCTCAAGGTGCGGCTGTTCGGGCTCGGGATGCTGGGGCCGAACG
GGCCGCTGCCGATCCACGTGACGGAGATCGCGCGCGATCGCGAGGAGAGCCGGCGCGATCCGACGCTCGG
CAATTTTCTCGATATCTTCCATCATCGCTATCTGACGCTGCTGTATCGCGCGTGGGCGTCGGCGCAGGCG
GTGGCCGGCCTCGATCGTCCGGACGACGAACGGTTTTCGTTCTACGTCGCGAGCCTCGCCGGCCAGGATC
TCGACGAGGTCGGCGCGCAGCCGCTGCCCGCGCACGCGCGGCTGTCCGCCTCGCCGCATCTGGTGCGCGA
GGCGCGCAACGCGGACGGCCTGCGAATGACGCTCGAACGTTACTTCGGCGTGCCGGTGACGCTGGAGGAA
AACGTATTTCACTGGATCGCCGTCGATCCGCTCGAGCACAGCCGGCTCGGCCGGCCCGGCGACGCATCGA
CGATGGCCGCGGGCGCGCTGCTCGGCGAGCTGGTGCCGGATCGGCAGCACAAGTTCCGGCTCGTGTTCGG
GCCGCTCGACATCGACGCCTATCTGCGCTTCACGCCGCGGGGCGAGGATCTGCCGCGGCTCGTCGAATGG
GTGCGGGCGTTCGTCGGCTACGAGTTCGAGTGGGAGCTCGAGTTGCGGATCAAGCCGAACGGCGCGCCGC
CCGCCGTGATGGGCGGCCCGCATCAACTCGGCTGGTCGGGCTGGCTCGGCCGCTCGCCGTCCGGCGAGCC
GGTGACGGGCATGCGTTTCGAACCCGAGCACTATGCGCACGGGTTCGCGCGCGGCACGGCTCGCGACACG
CGCGGCATGCGAGGTGAACGATGA